Nature 391, 43–50 (1998)
We have noticed that the sequence of murine CAD (Fig. 5d) carries an error. The sequence of the amino acids from 47 to 76 should read SRLCLYEDGTEVTDDCFPGLPNDAELLLL, instead of FPAVPVRRWHGGDGRLLPGPFPTTLSSYCF as published. The open reading frame of the cDNA (pEF-mCAD) consists of 344 amino acids instead of 345 amino acids, and the mature murine CAD is a protein of 342 amino acids with a calculated relative molecular mass of 39,214.18. The sequence for mouse CAD in the DDBJ/GenBank/EMBL database (accession number AB009377) has been revised (24 February 1998). This mistake does not change the substance of our findings or the interpretation of our data.
Additional information
The online version of the original article can be found at 10.1038/34112
Rights and permissions
About this article
Cite this article
Enari, M., Sakahira, H., Yokoyama, H. et al. Correction: A caspase-activated DNase that degrades DNA during apoptosis, and its inhibitor ICAD. Nature 393, 396 (1998). https://doi.org/10.1038/30782
Issue date:
DOI: https://doi.org/10.1038/30782
This article is cited by
-
Large scale and integrated platform for digital mass culture of anchorage dependent cells
Nature Communications (2019)
-
An overview of apoptosis assays detecting DNA fragmentation
Molecular Biology Reports (2018)
-
The nuclease activity of the endogenous differentiation factor of the HL-60 cell line
Russian Journal of Bioorganic Chemistry (2000)