Thanks to visit codestin.com
Credit goes to github.com

Skip to content

PeptoneLtd/PepTron

PepTron - Multi-domain Protein Ensemble Generator

bioRxiv DOI Source Code Source Code

PepTron is a sequence to ensemble generative model designed to accurately represent protein ensembles with any level of disorder content. This makes it the ideal choice for multi-domain proteins, which are the most common target class in cutting-edge therapeutics.

Demo

Installation

# Clone the repository
git clone https://github.com/PeptoneLtd/peptron.git
cd peptron

# Build Docker container
docker build -t peptron:latest .

# Run container
docker run --gpus all -it --rm peptron:latest

Pre-trained Models

Pre-trained PepTron checkpoints are available for download at https://zenodo.org/records/17306061.

  • PepTron: best performance across the whole proteome
  • PepTron-base: model pre-trained on the PDB, used for the fine-tuning on disordered regions to get PepTron

Quick Start

Inference

Generate protein structure ensembles from sequences:

1. Configuration

Modify the configuration in peptron/infer.py if needed (we suggest to keep the default):

EXEC_CONFIG = config_flags.DEFINE_config_file('config', 'peptron/model/config.py:peptron_o_inference_cueq')

2. Prepare Input

Create a CSV file with your protein sequences:

name,seqres
protein1,MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQA
protein2,MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDID

3. Download checkpoint

Download PepTron.tar.gz from here and unzip it.

The peptron-checkpoint directory is your checkpoint.

4. Run Inference

Using the convenience script:

# Edit run_peptron_infer.sh with your paths
export CKPT_PATH="/path/to/the/peptron-checkpoint"
export RESULTS_PATH="/path/to/results"
export CSV_FILE="/path/to/sequences.csv"

sh run_peptron_infer.sh

Training

1. Downloading Datasets

Here MSAs are need only for the processing and input pipelines and not used during the training.

PDB Dataset

To download and preprocess the PDB:

  1. Run aws s3 sync --no-sign-request s3://pdbsnapshots/20230102/pub/pdb/data/structures/divided/mmCIF pdb_mmcif from the desired directory.
  2. Run find pdb_mmcif -name '*.gz' | xargs gunzip to extract the MMCIF files.
  3. Prepare an MSA directory and place the alignments in .a3m format at the following paths: {alignment_dir}/{name}/a3m/{name}.a3m. If you don't have the MSAs, there are two ways to generate them:
    1. Query the ColabFold server with python -m dataprep.mmseqs_query --split [PATH] --outdir [DIR].
    2. Download UniRef30 and ColabDB according to https://github.com/sokrypton/ColabFold/blob/main/setup_databases.sh and run python -m scripts.mmseqs_search_helper --split [PATH] --db_dir [DIR] --outdir [DIR].
  4. From the repository root, run python -m dataprep.unpack_mmcif --mmcif_dir [DIR] --outdir [DIR] --num_workers [N]. This will preprocess all chains into NPZ files and create a pdb_mmcif.csv index.
  5. Download OpenProteinSet with aws s3 sync --no-sign-request s3://openfold/openfold from the desired directory.
  6. Run python -m dataprep.add_msa_train_info --openfold_dir [DIR] to produce a pdb_mmcif_msa.csv index with OpenProteinSet MSA lookup.
  7. Run python -m dataprep.cluster_chains to produce a pdb_clusters file at 40% sequence similarity (Mmseqs installation required).
  8. Create MSAs for the PDB validation split (splits/cameo2022.csv) according to standard MSA generation procedures and add_msa_val_info.
IDRome-o Dataset

The IDRome-o dataset has been created predicting the ensembles of the sequences in IDRome for respectively training and validation with https://github.com/PeptoneLtd/IDP-o.

To download and preprocess the IDRome-o dataset:

  1. Download IDRome-o from https://zenodo.org/records/17306061.
  2. Place the MSA directory in your preferred location
  3. From the repository root, run python -m dataprep.prep_idrome --split [FILE] --ensemble_dir [DIR] --outdir [DIR] --num_workers [N]. This will preprocess the IDRome trajectories into NPZ files. Do tha for both train and val splits.
  4. Run python -m dataprep.add_msa_train_info and python -m dataprep.add_msa_val_info
  5. Create MSAs for all entries in splits/IDRome_DB-train-msa.csv and splits/IDRome_DB-val-msa.csv according to standard MSA generation procedures.

2. Configuration

Modify the configuration in peptron/train.py based on your training strategy:

EXEC_CONFIG = config_flags.DEFINE_config_file('config', 'peptron/model/config.py:peptron_o_mixed')

3. Set Training Parameters

Edit peptron/model/config.py in the training section:

"training": {
    "experiment_dir": "/path/to/your/experiment/dir",
    "wandb_project": "peptron-stable",
    "experiment_name": "your-experiment-name",
    "n_steps_train": 2500,
    "warmup_steps_percentage": 0.10,
    "train_epoch_len": 80000,
    "val_epoch_len": 5,
    "micro_batch_size": 8,
    "num_nodes": 1,
    "devices": 8,
    "tensor_model_parallel_size": 1,
    "pipeline_model_parallel_size": 1,
    "accumulate_grad_batches": 1,
    "steps_to_save_ckpt": 100,
    "val_check_interval": 100,
    "limit_val_batches": 3,
    "precision": "bf16-mixed",
    "initial_nemo_ckpt_path": "/path/to/initial/checkpoint",

    # Data paths
    "train_data_dir_pdb": "/path/to/pdb_mmcif_npz_dir",
    "val_data_dir_pdb": "/path/to/pdb_mmcif_npz_dir", 
    "train_msa_dir_pdb": "/path/to/pdb_msa_dir",
    "val_msa_dir_pdb": "/path/to/cameo2022_msa_dir",

    # Chain files
    "train_chains_pdb": "splits/pdb_chains_msa.csv",
    "valid_chains_pdb": "splits/cameo2022_msa.csv", 
    "train_data_dir_idp": "/path/to/IDRome_train_dir",
    "train_msa_dir_idp": "/path/to/IDRome_train_msa_dir",
    "train_chains_idp": "splits/IDRome_DB-train-msa.csv",

    "mmcif_dir": "/path/to/pdb_mmcif_dir",
    "dataset_prob_pdb": 0.3,
    "dataset_prob_idp": 0.7,
    "train_clusters": "/path/to/pdb_clusters",
    "train_cutoff": "2020-05-01",

    "encoder_frozen": True,
    "structure_frozen": False,
    "pretrained_structure_head_path": "",
}

4. Run Training

# Single node training
sh run_peptron_train.sh

# Multi-node distributed training
sh run_peptron_distributed_train.sh

Configuration Options

Inference Parameters

Key parameters you can modify in the inference configuration:

  • samples: Number of ensemble conformations to generate (default: 10)
  • steps: Number of diffusion denoising steps (default: 10)
  • max_batch_size: Number of structures generated in parallel for each predicted ensemble (default: 1)
  • num_gpus : Number of GPUs PepTron will use during inference (default: 1)

NOTE1: The num_gpus parameter has to be $\leq$ the number of sequences in your CSV_FILE

NOTE2: The longer the sequence and the smaller max_batch_size has to be to avoid Out-Of-Memory errors. We set the default to 1 as safe configuration but we encourage to increase it based on your GPU memory and max-sequence-length. The bigger the ensemble you want to generate and the more you want to increase this parameter.

Training Parameters

Key parameters for training configuration:

  • flow_matching.noise_prob: Probability of adding noise during training
  • flow_matching.self_cond_prob: Self-conditioning probability
  • crop_size: Input sequence crop size for memory management

Evaluation

PeptoneBench

PepTron's performance compared to other structural models can be evaluated using PeptoneBench, https://github.com/PeptoneLtd/PeptoneBench.

To run PeptoneBench evaluation with PepTron:

  1. Install PeptoneBench following the instructions
  2. Generate PepTron ensembles for your target proteins using the inference pipeline above
  3. Use PeptoneBench to evaluate the generated ensembles against experimental observables

Troubleshooting

Common Issues

  1. CUDA Out of Memory: Keep micro_batch_size=1 and tune max_batch_size based on your needs.
  2. cuEquivariance Import Error: Ensure cuequivariance-torch is properly installed. Discard the torchdynamo warnings
  3. Checkpoint Loading Error: Verify checkpoint path and model configuration compatibility
  4. Training Convergence Issues: Check data paths and CSV file formats

Getting Help

  • Check the Issues for common problems
  • Review configuration examples in peptron/model/config.py
  • Ensure all data paths are correctly set in the training configuration

Impact and Applications

PepTron delivers the predictive accuracy required to finally characterize multi-domain proteins and IDPs, unlocking new frontiers in:

  • Drug Discovery: Accurate modeling of disordered therapeutic targets
  • Protein Engineering: Design of flexible, functional protein domains
  • Fundamental Biology: Understanding disorder's role in cellular processes
  • Therapeutic Development: Targeting the most common protein class in modern medicine

Citation

If you use PepTron in your research, please cite:

@article{peptone2025,
  title     = {Advancing Protein Ensemble Predictions Across the Order-Disorder Continuum},
  author    = {Invernizzi, Michele and Bottaro, Sandro and Streit, Julian O and Trentini, Bruno and Venanzi, Niccolo AE and Reidenbach, Danny and Lee, Youhan and Dallago, Christian and Sirelkhatim, Hassan and Jing, Bowen and Airoldi, Fabio and Lindorff-Larsen, Kresten and Fisicaro, Carlo and Tamiola, Kamil},
  year      = 2025,
  journal   = {bioRxiv},
  publisher = {Cold Spring Harbor Laboratory},
  doi       = {10.1101/2025.10.18.680935},
  url       = {https://www.biorxiv.org/content/early/2025/10/19/2025.10.18.680935}
}

License

Copyright 2025 Peptone Ltd

Licensed under the Apache License, Version 2.0. You may obtain a copy of the License at: http://www.apache.org/licenses/LICENSE-2.0

Acknowledgments

PepTron is developed through collaboration between Peptone Ltd, NVIDIA and the MIT, leveraging the BioNeMo platform for optimized biological AI computing. Special thanks to the computational biology community for advancing our understanding of protein disorder and dynamics.

About

Ensemble generator for multi-domain proteins

Resources

License

Code of conduct

Contributing

Stars

Watchers

Forks

Packages

No packages published

Contributors 6