Thanks to visit codestin.com
Credit goes to www.scribd.com

0% found this document useful (0 votes)
115 views64 pages

Clinical Trials, Second Edition

Uploaded by

braaemattie34
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
115 views64 pages

Clinical Trials, Second Edition

Uploaded by

braaemattie34
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 64

Full download test bank at ebook ebookmass.

com

Clinical Trials, Second Edition:


Study Design, Endpoints and
Biomarkers, Drug Safety, and FDA
and ICH Guidelines Tom Brody Phd
CLICK LINK TO DOWLOAD

https://ebookmass.com/product/clinical-
trials-second-edition-study-design-endpoints-
and-biomarkers-drug-safety-and-fda-and-ich-
guidelines-tom-brody-phd/

ebookmass.com
More products digital (pdf, epub, mobi) instant
download maybe you interests ...

Biomarkers in drug discovery and development: a


handbook of practice, application, and strategy Second
Edition Bleavins

https://ebookmass.com/product/biomarkers-in-drug-discovery-and-
development-a-handbook-of-practice-application-and-strategy-
second-edition-bleavins/

Cobert’s Manual of Drug Safety and Pharmacovigilance


3rd Edition

https://ebookmass.com/product/coberts-manual-of-drug-safety-and-
pharmacovigilance-3rd-edition/

Cancer Biomarkers: Clinical Aspects and Laboratory


Determination 1st Edition Lakshmi V. Ramanathan

https://ebookmass.com/product/cancer-biomarkers-clinical-aspects-
and-laboratory-determination-1st-edition-lakshmi-v-ramanathan/

Cobertu2019s Manual of Drug Safety and


Pharmacovigilance 3rd Edition, (Ebook PDF)

https://ebookmass.com/product/coberts-manual-of-drug-safety-and-
pharmacovigilance-3rd-edition-ebook-pdf/
Manual of Equine Anesthesia and Analgesia Second
Edition Tom Doherty

https://ebookmass.com/product/manual-of-equine-anesthesia-and-
analgesia-second-edition-tom-doherty/

The dentist's drug and prescription guide Second


Edition Froum

https://ebookmass.com/product/the-dentists-drug-and-prescription-
guide-second-edition-froum/

The Organic Chemistry of Drug Design and Drug Action


3rd Edition, (Ebook PDF)

https://ebookmass.com/product/the-organic-chemistry-of-drug-
design-and-drug-action-3rd-edition-ebook-pdf/

Second Language Research: Methodology and Design

https://ebookmass.com/product/second-language-research-
methodology-and-design/

Handbook for Building Construction: Administration,


Materials, Design, and Safety Clifford J Schexnayder

https://ebookmass.com/product/handbook-for-building-construction-
administration-materials-design-and-safety-clifford-j-
schexnayder/
CLINICAL TRIALS
SECOND EDITION
CLINICAL TRIALS
Study Design, Endpoints and
Biomarkers, Drug Safety,
and FDA and ICH Guidelines
SECOND EDITION

Tom Brody, Ph.D.

AMSTERDAM • BOSTON • HEIDELBERG • LONDON


NEW YORK • OXFORD • PARIS • SAN DIEGO
SAN FRANCISCO • SINGAPORE • SYDNEY • TOKYO
Academic Press is an imprint of Elsevier
Academic Press is an imprint of Elsevier
125, London Wall, EC2Y 5AS.
525 B Street, Suite 1800, San Diego, CA 92101-4495, USA
50 Hampshire Street, 5th Floor, Cambridge, MA 02139, USA
The Boulevard, Langford Lane, Kidlington, Oxford OX5 1GB, UK
Second Edition 2016
Copyright r 2016, 2012 Elsevier Inc. All rights reserved.
No part of this publication may be reproduced or transmitted in any form or by any means, electronic or mechanical,
including photocopying, recording, or any information storage and retrieval system, without permission in writing from
the publisher. Details on how to seek permission, further information about the Publisher’s permissions policies and our
arrangements with organizations such as the Copyright Clearance Center and the Copyright Licensing Agency, can be
found at our website: www.elsevier.com/permissions.
This book and the individual contributions contained in it are protected under copyright by the Publisher
(other than as may be noted herein).

Notices
Knowledge and best practice in this field are constantly changing. As new research and experience broaden our
understanding, changes in research methods, professional practices, or medical treatment may become necessary.
Practitioners and researchers must always rely on their own experience and knowledge in evaluating and using any
information, methods, compounds, or experiments described herein. In using such information or methods they should
be mindful of their own safety and the safety of others, including parties for whom they have a professional
responsibility.
To the fullest extent of the law, neither the Publisher nor the authors, contributors, or editors, assume any liability
for any injury and/or damage to persons or property as a matter of products liability, negligence or otherwise,
or from any use or operation of any methods, products, instructions, or ideas contained in the material herein.
ISBN: 978-0-12-804217-5
British Library Cataloguing-in-Publication Data
A catalogue record for this book is available from the British Library.
Library of Congress Cataloging-in-Publication Data
A catalog record for this book is available from the Library of Congress.

For Information on all Academic Press publications


visit our website at http://store.elsevier.com/

Publisher: Mica Haley


Acquisition Editor: Kristine Jones
Editorial Project Manager: Molly McLaughlin
Production Project Manager: Julia Haynes
Designer: Greg Harris
Typeset by MPS Limited, Chennai, India
www.adi-mps.com
Dedication

To Shideh and Dawnia


Acknowledgments

I thank Julia Haynes, Molly McLaughlin, guidance on run-in periods. I am most grateful
Kristine Jones, and April Graham of Elsevier, to David Cella, Barbara Vickrey, Andrea
Inc., for their devotion and expertise in the (Andy) Trotti, and Jinny Tavee, for help on
editing and production phases of this book. health-related quality-of-life (HRQoL) instru-
I am indebted to Dr Waihei A. Chu, ments. I thank Jeffrey A. Cohen for his detailed
PharmD, for his guidance in the field of regula- responses to my questions on multiple sclerosis.
tory writing. In his own words: I thank the Also, I am grateful to Ching-Hon Pui, James B.
following people for answering specific ques- Nachman, Eric E. Hedrick, Stacey L. Berg, and
tions during the course of this project. Nearly Tanja Hartmann for their insights regarding
all of these persons are physicians and principal the leukemias. I acknowledge Margaret von
investigators in clinical trials in oncology, multi- Mehren for information on gastrointestinal stro-
ple sclerosis, and infectious diseases. Many of mal tumors. I thank Bruce A. Roe for modifying
these persons are thought-leaders in the field of my diagram of the Philadelphia chromosome,
study design or are tenured professors in medi- and I thank Adele K. Fielding for further guid-
cal schools. I thank Masha Hareli, Amit Bar-Or, ance on this chromosome. I am also grateful to
and Olaf Steve, for authoritative guidance Jake Liang and Robert E. Lanford for explaining
on multiple sclerosis. I thank Christina Slover relations between IFN-alpha and IFN-gamma,
for guidance on drug drug interactions. I am as they apply to hepatitis C virus.
grateful to Patrick Archdeacon, Patricia Harley, I thank Martin E. Stryjewski, Jonathan S.
Michelle Eby, and Joette M. Meyer, all of the Berek, James Cassidy, Olivier Leroy, and
FDA, for information on various aspects of the Michael E. Pichichero, for help on per protocol
FDA approval process. I am grateful to Peter C. analysis and intent-to-treat analysis. I thank
Raich for granting permission to reproduce Lawrence Rubinstein, Thomas G. Roberts Jr,
his consent forms, and I thank David Cella for Thomas J. Lynch, Murray D. Norris, Bradley
sending me these forms. I thank Marc Buyse, R. Prestidge, and Igor Sherman, for informa-
Tomasz Burzykowski, Daniel J. Sargent, Gerold tion on subgroups or on inclusion/exclusion
Bepler, Sally Stenning, John Hainsworth, criteria.
Sanjiv S. Agarwala, Clifford A. Hudis, Axel I am grateful to Peter J. Barrett-Lee for infor-
Grothey, Wen-Jen Hwu, Keith Wheatley, Joseph mation on drug safety. I thank Anthony Viera
A. Sparano, Elizabeth A. Eisenhauer, Miguel for information on randomization. I thank
Martin, and Linda Colangelo, for their expert Syed Y. Zafar and Richard L. Schilsky for their
guidance on endpoints. I am deeply grateful expertise on best supportive care and palliative
to Frank Worden and Bruce E. Johnson for care. I acknowledge Karen Mosher for her

xv
xvi ACKNOWLEDGMENTS

expertise on decision aids, as it relates to I thank Tiiamari Pennanen for information on


consent forms. I am grateful to Elizabeth B. the history of the European Medicines Agency,
Andrews, Balall Naeem, Michael Klepper, and and Dominic Stevenson and Sarah Heffer for
Barry D.C. Arnold, for their knowledge advice on the Yellow Card. For the first edition
regarding the CIOMS I form. I thank Patricia of this book, I thank Jenna Elder and Harvey
Mozzicato for her time answering questions Motulsky for reviewing the draft chapter on
about the MedDRA terminology. Moreover, biostatistics.
Preface

This book is a pharmacology textbook. It can administering the study drug, and collecting
serve a handbook for all personnel involved in data on efficacy and safety (1).
regulated clinical trials, including employees at Also, to ensure that the book is a lively
the US Food and Drug Administration (FDA) and compelling textbook and handbook, the
and the European Medicines Agency (EMA). text provides the history of consent forms
The book quotes extensively from comments using the example of Walter Reed’s yellow
by FDA reviewers, which are published on the fever study, the history of the FDA and the
FDA’s website at the time that the FDA grants EMA, background information on assay meth-
approval to a drug. In other words, along ods in biochemistry and immunology, and
with the FDA’s approval letter, the FDA also quotations from published courtroom opinions
publishes its Medical Reviews, Clinical Reviews, relating to clinical trials.
Pharmacology Reviews, and other documents, This book fulfills various unmet needs, as
each of which includes comments from various detailed below.
FDA personnel.
The content of these reviews closely tracks
the Sponsor’s Integrated Summary of Safety (ISS), THE STUDY SCHEMA AND
submitted as part of an NDA or BLA. It is there- STUDY DESIGN
fore the case that this book provides an accurate
representation of what the FDA looks for (and The best way to communicate trial design is
complains against), during its review of submis- with a flow chart or table called the schema.
sions from a Sponsor’s phase II and phase III The author observed that the schema is
clinical trials. In all, the author made use of the rarely detailed in any explicit way by books or
Medical Reviews and Clinical Reviews that accom- journal articles. Unfortunately, books on clinical
panied about 75 of the FDA’s approval letters. trials generally refrain from disclosing much on
In this book, the words “Sponsor” and trial design, for example, regarding the various
“investigator” are sometimes used inter- goals of the run-in period, or regarding decision
changeably, though it should be noted that the trees that may modify drug dosing during the
Sponsor is the party that initiates a clinical course of an ongoing trial. This book provides a
trial, while an investigator is the party that thorough introduction to study design, includes
actually does the work, such as the work of many representative diagrams of the study
writing the Clinical Study Protocol and other schema, and details several distinct reasons for
FDA-submissions, enrolling study subjects, including a run-in period.

1
American Academy or Pediatrics Policy Statement. Off-label use of drugs in children. Pediatrics 2014;133:563 7.

xvii
xviii PREFACE

INTENT-TO-TREAT ANALYSIS This book fulfills an unmet need by providing


AND PLACEBOS a more detailed account on how to choose the
most appropriate oncology endpoint, and on
Second, the authors observed that other when to refrain from using a given endpoint.
aspects of clinical trials are inadequately
described in textbooks, for example, they were
covered only by a short paragraph. These DIAGNOSTIC TESTS
aspects include intent-to-treat (ITT) analysis,
modified ITT (mITT) analysis, and per protocol Fourth, this book takes care to integrate
(PP) analysis. ITT analysis is a term that is diagnostic tests with each disease. What are
almost universally used in clinical trials, but described are disability status questionnaires,
the available textbooks on clinical trial design HRQoL questionnaires, blood counts, flow
typically fail to describe ITT analysis, mITT cytometry, immunoassays, polymerase chain
analysis, or PP analysis, and how to choose reaction (PCR), microarrays, and magnetic res-
between these three types of data analysis. onance imaging (MRI). Moreover, this book
This book contains an entire chapter on ITT, provides an introduction to the process of
mITT, and PP analyses. It is also the case that FDA approval for diagnostics tests.
most or all books on clinical trials fail to
include any organized account of placebos.
This book has an entire chapter on placebos. MECHANISM OF ACTION
Fifth, the book describes the mechanisms of
HOW TO CHOOSE ENDPOINTS various diseases and the mechanisms of action
of various drugs. These mechanisms are inte-
Third, definitions of endpoints used in grated into the context of clinical trials, in com-
oncology clinical trials are frequently disclosed mentary demonstrating how the mechanism of
in the available textbooks, but unfortunately, action can influence the inclusion/exclusion
textbooks generally fail to state the advantages criteria, warnings on consent forms, and infor-
of any given endpoint over another, and fail to mation on package inserts. This book also
state situations where a particular endpoint describes how the mechanism of action can
gives ambiguous information or where an end- influence study design, that is, the particular
point cannot be used. These oncology end- combination and timing of administered drugs.
points include objective response rate (ORR), The book reveals that a knowledge of the mech-
overall survival (OS), progression-free survival anism of action can encourage regulatory agen-
(PFS), time to progression (TTP), time to dis- cies to allow a clinical trial to be initiated.
tant metastasis (TDM), disease-free survival
(DFS), 6-month PFS, and health-related quality
of life (HRQoL). The FDA’s Guidance for STANDARDS
Industry (2) provides a fine introduction to
these endpoints, but refrains from detailing, Sixth, the text emphasizes the role of vari-
for example, situations where any given end- ous standards that apply to clinical trials.
point is likely to be unreliable or unusable. These standards include criteria for measuring
2
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry. Clinical
trial endpoints for the approval of cancer drugs and biologicals; 2007 (19 pp.).
PREFACE xix
physical fitness, such as the Eastern These two instruments are the FDA’s Form 483
Cooperative Oncology Group (ECOG) score, notices and the FDA’s Warning Letters.
Karnofsky score, and the Kurtzke Expanded Quotations from the FDA’s Warning Letters
Disability Status Scale (EDSS) score, criteria for are included at various points in this book. A
measuring tumor size and number (Response sustained account of the FDA’s Warning
Evaluation Criteria in Solid Tumors, RECIST Letters, as well as a description of their rela-
criteria), and criteria for staging tumors tion to the FDA’s Form 483, appears in one of
[Tumor Node Metastasis (TNM) staging; the last chapters in this book.
Dukes’ staging]. The text provides a warning
about potential confusion that can arise, when
two different sets of standards are applied to
one disease. This warning takes the form of a CLINICALTRIALS.GOV AND
narrative on the Will Rogers Phenomenon. OTHER REGISTRIES FOR
The administrative law, and guidance docu- CLINICAL TRIALS
ments from regulatory agencies, constitute
another type of standard. These standards ClinicalTrials.gov is a registry of clinical
are also revised from time to time. The trials, developed by the FDA and NIH, and
ICH Guidelines and the FDA’s Guidance for first operational in 2000 (3). In 2007, the Food
Industry documents constitute a recurring and Drug Administration Amendments Act
theme in this textbook. (FDAAA) imposed the requirement that spon-
sors of clinical trials register and report sum-
mary results at www.ClinicalTrials.gov (4). As
of Jan. 2009, ClinicalTrials.gov had more than
FDA’S WARNING LETTERS 67,000 registered trials (5). About one-quarter
of these trials are sponsored by pharmaceutical
This textbook uses the FDA’s Warning companies. Zarin et al. (6) describe the content
Letters as a source material. The FDA issues of this website.
Warning Letters to manufacturers of drugs, The European Union provides the EU
medical devices, foods, and dietary supple- Clinical Trials Registry, which contains infor-
ments. Generally, these letters include com- mation on clinical trials that were conducted in
plaints about a company’s failure to comply the European Union, starting after May 1, 2004.
with one or more sections of Title 21 of the This Registry contains information that was
Code of Federal regulations. The FDA uses entered by Sponsors of clinical trials. The infor-
two different instruments for complaining mation, which appears in the EudraCT data-
about failures to follow various sections of base, can be searched by the public, and the
Title 21 of the Code of Federal Regulations, for information includes the trial design, Sponsor,
the situation where the failures are detected medicine, therapeutic area, summary of results,
during an FDA inspection of the Sponsor’s and whether the trial is merely authorized, or
clinical facilities or manufacturing facilities. is ongoing or complete. EudraCT is provided
3
Steinbrook R. Public registration of clinical trials. New Engl. J. Med. 2004;351:315 7.
4
Anderson ML, et al. Compliance with results reporting at ClinicalTrials.gov. New Engl. J. Med. 2015;372:1031 9.
5
Wood AJ. Progress and deficiencies in the registration of clinical trials. New Engl. J. Med. 2009;360:824 30.
6
Zarin DA, Tse T, Williams RJ, Califf RM, Ide NC. The ClinicalTrials.gov results database—update and key issues.
New Engl. J. Med. 2011;364:852 60.
xx PREFACE

in 24 different languages. The step at which A similar service for ongoing and completed
the user can select the language, is provided on studies is available from the International
the world wide web at: www.eudrapharm.eu/ Federation of Pharmaceutical Manufacturers &
eudrapharm/. Any member of the public can Associations (IFPMA) (http://www.ifpma.org/
input query terms such as the trade name or clinicaltrials) (11).
the chemical name of the drug. The FDA Amendments Act, enacted in Sep.
Registries that are not affiliated with any 2007. Congress expanded the requirements
governmental agency include, for example, for sponsors and investigators to post informa-
the TYSABRI Pregnancy Exposure Registry. This tion about clinical trials, including selected
registry is identified on the package insert aspects of trial results, on ClinicalTrials.gov (12).
for Tysabri, which states that, “[i]f a woman Requirements relevant to registration are set
becomes pregnant while taking TYSABRI, con- forth in Section 801 of this Act. Section 801 man-
sider enrolling her in the TYSABRI Pregnancy dates registration on ClinicalTrials.gov of all
Exposure Registry by calling 1-800-456-2255” (7). new controlled clinical investigations (other
Each study has a unique registration number. than phase I) of drugs, biologics, and devices
Another registry used for clinical trials is the subject to regulations by the FDA. This applies
International Standard Randomised Controlled to research for any condition, regardless of spon-
Trial Number (ISRCTN) (8). Where a clinical sor type, for example, industry, government, or
trial is conducted in only one country, study academic (13). New clinical studies must be reg-
information should be entered only in one regis- istered within 21 days after the first patient is
ter, to avoid duplication and confusion. enrolled, where updates of the registry informa-
However, companies that perform international tion must occur at least every 12 months.
clinical studies may be required to register their Recruitment status should be updated within 30
trial in a national clinical study register, as days of any change. Dec. 2007 was the due date
well as in an international clinical study register to start registering new studies or updating all
(9). The WHO International Clinical Trials required information fields for ongoing studies
Registry Platform (ICTRP) provides a search (14,15). One of the FDA’s Guidance for Industry
portal to locate trials from many primary regis- documents, Providing Regulatory Submissions in
tries worldwide (http://www.who.int/ictrp/ Electronic Format, provides guidance for register-
en/). This registry began operating in 2005 (10). ing your clinical trial (16).

7
TYSABRI (natalizumab) Injection Full Prescribing Information. Biogen IDEC, Inc.; January 1, 2012 (32 pp.).
8
Thomas KB, Tesch C. Clinical trial disclosure-focusing on results. The Write Stuff. 2008;17:70 3.
9
Thomas KB, Tesch C. Clinical trial disclosure-focusing on results. The Write Stuff. 2008;17:70 3.
10
Sim I. Trial registration for public trust: making the case for medical devices. J. Gen. Intern. Med. 2008;23
(Suppl. 1):64 8.
11
Thomas KB, Tesch C. Clinical trial disclosure-focusing on results. The Write Stuff. 2008;17:70 3.
12
Wood AJ. Progress and deficiencies in the registration of clinical trials. New Engl. J. Med. 2009;360:824 30.
13
Thomas KB, Tesch C. Clinical trial disclosure-focusing on results. The Write Stuff. 2008;17:70 3.
14
Thomas KB, Tesch C. Clinical trial disclosure-focusing on results. The Write Stuff. 2008;17:70 3.
15
Wood AJJ. Progress and deficiencies in the registration of clinical trials. New Engl. J. Med. 2009;360:824 30.
16
U.S. Department of Health and Human Services. Food and Drug Administration. Providing regulatory
submissions in electronic format—drug establishment registration and drug listing; May 2009 (13 pp.).
PREFACE xxi
Although Public Law No. 110-85 contains a patient enrollment, as a condition for publica-
section named, Section 801, the law only has tion (18). In observing that trial registration is
88 sections. Section 801 is reproduced, in part, largely voluntary, and that registries contain
below (17): only a small proportion of trials, the ICMJE
proposed that trial registration be a solution
(i) SEARCHABLE CATEGORIES.—The Director to the problem of selective awareness, and set
of NIH shall ensure that the public may, in addition forth the goal that ICMJE member journals
to keyword searching, search the entries in the regis- require (as a condition of consideration for
try data bank by 1 or more of the following criteria:
(I) The disease or condition being studied in the
publication) registration in a public trials regis-
clinical trial, using Medical Subject Headers (MeSH) try (19,20). Trials must register at or before
descriptors. the onset of patient enrollment. Hirsch (21)
(II) The name of the intervention, including any and others (22,23) provide comments on this
drug or device being studied in the clinical trial. policy. In a survey of editorial policies of 165
(III) The location of the clinical trial.
(IV) The age group studied in the clinical trial, medical journals, Hopewell et al. (24), found
including pediatric subpopulations. that 44 specially require that the clinical trial
(V) The study phase of the clinical trial. be registered before submitting the manuscript
(VI) The sponsor of the clinical trial, which may to the journal.
be the National Institutes of Health or another According to the FDA’s Guidance for
Federal agency, a private industry source, or a uni-
versity or other organization. Industry document on good pharmacovigilance
(VII) The recruitment status of the clinical trial. practices, a sponsor may establish or create a
(VIII) The National Clinical Trial number or new registry, for example, for the goals of
other study identification for the clinical trial. evaluating safety signals identified from sponta-
neous case reports or from literature reports,
The International Committee of Medical and for evaluating factors that affect the risk
Journal Editors (ICMJE) adopted the policy of adverse outcomes, such as dose, timing of
that clinical trials be registered at the onset of exposure, or patient characteristics (25).

17
Public Law 110-85. 110th Congress. September 27, 2007. Food and Drug Administration Amendments of 2007.
18
Foote M. Clinical trial registries and publication of results—a primer. In: Foote M, editor. Clinical trial registries
a practical guide for sponsors and researchers of medicinal products. Basel, Switzerland: Birkhäuser Verlag; 2006.
pp. 1 12.
19
De Angelis CD, Drazen JM, Frizelle FA, et al. Is this clinical trial fully registered?—A statement from the
International Committee of Medical Journal Editors. New Engl. J. Med. 2005;352:2436 8.
20
De Angelis CD, Drazen JM, Frizelle FA, et al. Clinical trial registration: a statement from the International
Committee of Medical Journal Editors. J. Am. Med. Assoc. 2004;292:1363 4.
21
Hirsch L. Trial registration and results disclosure:impact of US legislation on sponsors, investigators, and
medical journal editors. Curr. Med. Res. Opin. 2008;24:1683 9.
22
Bonati M, Pandolfini C. Trial registration, the ICMJE statement, and paediatric journals. Arch. Dis. Child
2006;91:93.
23
Sekeres M, Gold JL, Chan AW, et al. Poor reporting of scientific leadership information in clinical trial registers.
PLoS One 2008;3:e1610.
24
Hopewell S, Altman DG, Moher D, Schulz KF. Endorsement of the CONSORT Statement by high impact factor
medical journals: a survey of journal editors and journal ‘Instructions to Authors’. Trials 2008;9:20.
25
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry. Good
pharmacovigilance practices and pharmacoepidemiologic assessment; March 2005 (20 pp.).
xxii PREFACE

This book emphasizes cancer for a number of cancer clinical trials is greater than for other
of reasons. Therapy for cancer involves more diseases. In Jan. 2011, about 27,000 cancer trials,
variables, more drug candidates, and more drug 4190 trials on immunological diseases (sum of
combinations, than therapy for other diseases. arthritis, multiple sclerosis, lupus, psoriasis,
Hence, there is a greater need to provide a Crohn’s disease, and ulcerative colitis), 5180
harmonious description of trial design and end- trials on diabetes, and 690 trials on atherosclero-
points, as it applies to cancer. Also, the number sis, were identified on www.ClinicalTrials.gov.
Introduction

Where a drug or medical device is tested laboratory values in chemistry and hematology,
on human subjects, the test may be called a or images from computed tomography and
clinical trial. Clinical trials may be conducted magnetic resonance imaging (MRI).
in an academic setting, where the goals are to In clinical trials, the main goals are captur-
obtain knowledge on the mechanism of action, ing and analyzing data on safety and efficacy.
efficacy, and pharmacokinetics of the drug. It is usually not the goal to ensure that study
Clinical trials are also conducted by the phar- subjects recover from their disorder.
maceutical industry, where the goals are to Trials intended for regulatory approval by
obtain knowledge on safety, efficacy, pharma- the US Food and Drug Administration (FDA),
cokinetics, and mechanism of action, and to as well as monitoring activities in the post-
obtain regulatory approval. approval context, are regulated by the United
The structure of clinical trials is set forth in a States Code (USC) and by the administrative
document called the Clinical Study Protocol. law, that is, the Code of Federal Regulations
Clinical Study Protocols contain a number of (CFR). The term “administrative law” refers to
common elements, or concepts, despite the the rules in the CFR. The USC contains sta-
variety of drugs being tested, and the variety of tutes, whilst the CFR contains rules. The rele-
diseases. These common elements include inclu- vant statutes are found in Title 21 of the USC
sion and exclusion criteria for the study subjects, (21 USC y355).
subgroups of the study population, methods for The relevant administrative law (or rules) is
stratifying the study subjects, techniques for found in Title 21 and Title 45 of the CFR, as
recruitment, obtaining consent, randomization, indicated below:
and allocation, and statistical methods for data
• Investigational New Drug (IND)
presentation and analysis. The Clinical Study
(21 CFR y312)
Protocol includes a summary called the synopsis
• New Drug Application (NDA)
and a flow chart called the study schema. The
(21 CFR y314)
schema provides the study design, the identity
• Investigator’s Brochures (IB) (21 CFR y312)
of the study drug and control, and an identifica-
• Integrated Summary of Safety (ISS)
tion of some of the endpoints.
(21 CFR y314.50 (d)(5))
Endpoints in any given clinical trial may
• Integrated Summary of Efficacy (ISE)
relate, for example, to tumor size, the number of
(21 CFR y314.50 (d)(5))
lesions in an organ or tissue, the concentration
• Consent form (21 CFR y50 and 45 yCFR 46)
of bacteria or viruses in the bloodstream, or to
• Package insert (21 CFR y201.10 and 21 CFR
a metabolite or hormone in the bloodstream.
y201.56)
Endpoints can take the form of relatively subjec-
• Data Monitoring Committee Charter (DMC
tive data from questionnaires filled out by study
Charter) (21 CFR y312.50 and 45 CFR y46).
subjects, or of relatively objective data, such as

xxiii
xxiv INTRODUCTION

I. GOOD CLINICAL PRACTICE data and non-clinical data. These data include
those arising apart from the study, for example,
Clinical trials intended for regulatory from reports from animal studies and from clin-
approval should conform to a set of guidelines ical trials conducted by other investigators, as
known as, Good Clinical Practice (GCP). well as data from human subjects arising from
According to the ICH Guidelines: the study itself. Most of the information set
forth in this textbook can be viewed in the con-
Good Clinical Practice is an international ethical text of Good Clinical Practice.
and scientific quality standard for designing, con- The ICH Good Clinical Practice Guidelines
ducting, recording and reporting trials that involve sets forth international standards for the qual-
the participation of human subjects. Compliance
ity, safety, and efficacy of developmental-stage
with this standard provides public assurance that
the rights, safety and well-being of trial subjects are pharmaceutical products. The ICH Good
protected, consistent with the principles that have Clinical Practice Guidelines were made binding
their origin in the Declaration of Helsinki, and that by the EU Clinical Trials Directive in 2004.2
the clinical trial data are credible 1. They require the sponsor to verify the qualifica-
tions of the investigators, obtain informed
GCP encompasses the requirement that the consent before each subject’s participation in
clinical study be approved by an independent the trial, ensure the trials are adequately moni-
ethics board, such as an Institutional Review tored, and that the institutional review board
Board (IRB), prior to initiating the clinical (IRB) reviews and approves the Clinical Study
study. GCP also encompasses the requirements Protocol, and oversee the trial.
that study subjects give informed consent prior This textbook frequently refers to the ICH
to entering the study, that records of study Guidelines and the FDA’s Guidance for
subjects be kept confidential, that investigators Industry documents, and uses these documents
be properly qualified by education and training, as anchor points for the various narratives.
that adequate medical care be given to any
study subjects who suffer from study-related
adverse events, that serious adverse events
be immediately reported to the sponsor, and II. FDA’S DECISION-MAKING
that study drugs and placebo (if any) be manu- PROCESS IN GRANTING
factured according to Good Manufacturing APPROVAL TO A DRUG
Practices (GMP).
The ICH Guideline for Good Clinical This textbook is unique in its extensive use
Practice also provides the organization and con- of documents published by the FDA at the
tent of the Clinical Study Protocol. The Clinical time the FDA grants approval to a drug. These
Study Protocol is, in essence, the instruction document are published by the FDA, in its
manual used by persons involved in conduct- response to an NDA or BLA submitted by a
ing the trial. Additionally, the ICH Guideline Sponsor. The decision-making processes lead-
for Good Clinical Practice details the organiza- ing to regulatory approval of various drugs are
tion and content of the Investigator’s Brochure available, in part, on the website of the FDA.
(IB), a document that compiles relevant clinical The available documents, which are published
1
ICH Harmonised Tripartite Guidelines. Guideline for Good Clinical Practice E6 (R1). Step 4 version, June 1996.
2
Hathaway CR, Manthei JR, Haas JB, Scherer CA. Looking abroad: clinical drug trials. Food and Drug Law
Journal. 2008; 63:673 681.
INTRODUCTION xxv
at the time that the FDA grants approval to a harsh complaints, such as those involving a
drug, include: Clinical Hold or a Refuse to File notice, and where
these complaints were eventually overcome by
• Approval Letter
the Sponsor. Moreover, because the Reviews
• Package Insert
are published at the time of FDA approval, it is
• Medical Review or Clinical Review
the case that these Reviews often emphasize
• Pharmacology Review
postmarketing requirements that were imposed
• Statistical Review
by the FDA, for example, the requirement to
• Package Insert
conduct confirmatory clinical trials, in the case
• Administrative Documents and
of a trial that had received an accelerated
Correspondence.
approval, or the requirement to include an
For the Reviews, it is the case that FDA REMS in the postmarketing situation.
reviewers reproduce some of the data that had
been submitted by the Sponsor, re-analyze the
results, and come to their own conclusions. The
Reviews include clearly labeled comments from III. DISCLAIMER
the reviewers. These comments provide invalu-
able guidance from the ultimate authority on The following is a disclaimer. The present
the types of study design and data that are writing does not constitute legal advice, and it
needed to influence the FDA to grant approval. does not establish any relationship between
These comments sometimes take the form of the reader and the authors. A goal of the pres-
complaints, however, since the Reviews are ent writing is to facilitate communication
published at the time of FDA approval, it between investigators in pharmaceutical com-
is generally not the case that the complaints panies and their attorneys, in matters limited
are harsh enough to bring a halt to the drug- to consent forms, package inserts, and patents.
approval process. On occasion, parts of the The opinions set forth herein do not necessar-
FDA’s Reviews that correspond to an earlier ily reflect the opinions of the authors’ past,
phase of the drug-approval process will reveal present, or future employers.
Abbreviations and Definitions

ADCC antibody-dependent cell cytotoxicity COPD chronic obstructive pulmonary disease


ADME absorption, distribution, metabolism, and excretion CR complete response. Complete response is a type of
ADR adverse drug reaction objective response. “Objective response” means asses-
AE adverse event sing tumor size and number, as described by the
ALL acute lymphocytic leukemia; acute lymphoblastic RECIST criteria. CR is also used to refer to a totally
leukemia different parameter, complete remission
AML acute myeloid leukemia; acute myelogenous leukemia CRF Case Report Form
APC antigen presenting cell. APCs include cells of the CRP C-reactive protein
immune system, for example, dendritic cells and macro- CTCAE Common Terminology Criteria for Adverse
phages. Antigens, which take the form of peptides and Events
oligopeptides, are noncovalently bound to MHC, and DC dendritic cell
are presented to T cells by way of the MHC, where pre- DFS disease-free survival
sentation occurs in an immune synapse that involves DMC Data Monitoring Committee
the APC and a T cell DNA deoxyribonucleic acid
ASCO American Society of Clinical Oncology DSMC Data and Safety Monitoring Committee
AUC area under the curve of concentration, in serum or ECG electrocardiogram
plasma, over time. The AUC represents the overall ECOG Eastern Cooperative Oncology Group
impact of a drug, over the course of time, to organs, ECRIN European Clinical Infrastructure Network
tissues, and cells, in the physiological milieu EGF epidermal growth factor
bid “bid in die,” which is Latin for twice a day EMA; EMEA European Medicines Agency. EMEA was
Cmax maximum concentration in plasma or serum. the formerly used abbreviation, but in Dec. 2009 the
Plasma refers to blood containing an anticoagulant, abbreviation was changed to EMA
with blood cells removed. Serum prepared by allowing FDA US Food and Drug Administration
blood naturally to clot, followed by discarding the clot FDA Form 356h the form used to submit an NDA or BLA
and the blood cells FDA Form 483 Form 483 is sometimes issued during the
Cmin minimum concentration in plasma or serum time of an FDA inspection of a clinical or manufacturing
CBER Center for Biologics Evaluation and Research facility. If the problems are not corrected in due course,
CD cluster of differentiation. The CD nomenclature refers FDA may follow-up by issuing a Warning Letter
to cell-surface proteins of immune cells, and is used to FDA Form 1571 the form used to submit an IND
identify immune cells FOLFIRI anticancer therapy using folinic acid, fluoroura-
CDER Center for Drug Evaluation and Research cil, and irinotecan. Folinic acid, also known as leucovor-
CFR; C.F.R. Code of Federal Regulations in, is a trivial name for 5-formyl-tetrahydrofolic acid
CI confidence interval FPI Full Prescribing Information. FPI is the US Food and
CIOMS Council for International Organizations of Drug Administration’s name for part of the package insert
Medical Sciences 5-FU 5-fluorouracil
CLL chronic lymphocytic leukemia; chronic lymphoblas- GCP Good Clinical Practices
tic leukemia GLP Good Laboratory Practices
CMI Consumer Medication Information Gy Gray (1 gray 5 1 J/kg and also equals 100 rad). The
CML chronic myeloid leukemia; chronic myelogenous gray is a unit of absorbed energy per mass of tissue
leukemia HCV hepatitis C virus
CONSORT Consolidated Statement of Reporting Trials HERG gene human ether-related a-go-go gene

xxvii
xxviii ABBREVIATIONS AND DEFINITIONS

HIPAA Health Insurance Portability and Accountability NOAEL no-observed adverse effect level. This term is
Act used in toxicology, in the context of using animal stud-
HR hazard ratio ies to arrive at a human dose
HRQoL health-related quality of life, or simply, QoL. NS2 nonstructural protein 2 of hepatitis C virus
IB Investigator’s Brochure NS5A nonstructural protein 5A of hepatitis C virus
ICH International Conference Harmonization OR objective response
ICMJE International Committee of Medical Journal Editors OS overall survival
ICSR Individual Case Safety Reports P value assuming that there is no actual difference in the
IM intramuscular means between two groups of data, the P value is the
IND Investigational New Drug application probability of finding a difference (a difference arising
IP intraperitoneal or intraperitoneally by chance alone) between the means of the two groups
ITT intent to treat, as in, “intent-to-treat analysis” that is as large, or larger, than the experimentally
IV intravenous or intravenously observed difference
IVRS interactive voice response systems PBMCs peripheral blood mononuclear cells. The term
LDH lactic dehydrogenase PBMCs refers to a preparation of bulk leukocytes.
LLOQ lower limit of quantification PBMCs include T cells, B cells, NK cells, and monocytes,
M molarity; moles per liter and they may include circulating tumor cells. PBMCs
MABEL minimum anticipated biological effect level do not include red blood cells and polymorphonuclear
MDS myelodysplastic syndromes (MDS is a genus of leukocytes (neutrophils)
related diseases) PCR polymerase chain reaction. PCR is a technique for
MedDRA Medical Dictionary for Regulatory Activities reproducing, in a reiterative and exponential manner, a
Terminology region of double-stranded DNA
MHC major histocompatibility complex. The MHC is a PD progressive disease
complex of membrane-bound proteins, expressed by a PDR Physician’s Desk Reference. The PDR contains
dendritic cell, that is used to hold antigenic peptides. reproductions of package inserts, including the black
The MCH presents the antigenic peptides to a T cell, box warnings of the inserts
that is, to the T cell receptor of a T cell. In response, the PFS progression-free survival
T cell is activated. The complex of MHC (residing on a pH negative log of hydrogen ion concentration
dendritic cell) and the T cell receptor (residing on a T PK pharmacokinetics. PK refers to drug concentrations,
cell) is called the immune synapse over the course of time, during absorption, distribution,
MHRA Medicines and Healthcare products Regulatory metabolism, and excretion, of any administered drug.
Agency Pharmacodynamics, in contrast, refers to the physiologi-
miRNA micro-RNA; micro-ribonucleic acid cal responses of organs, tissues, cells, and genes, to an
mL milliliter administered drug
MOG myelin oligodendrocyte glycoprotein PP per protocol, as in “per protocol analysis”
MRD minimal residual disease. MRD refers to the PPI Patient Package Insert
amount of leukemic blood cells following therapy PR partial response
against leukemia. For MRD analysis, the blood cells can PSUR Periodic Safety Update Reports
be acquired from the bone marrow or from peripheral QT interval Time (ms) between Q wave and T wave
blood, and then identified. Identification employs the QTc interval corrected QT interval
polymerase chain reaction, a technique that can detect RCT randomized controlled trial; randomised controlled
mRNA specific to leukemic cells trial (British spelling)
MTX methotrexate. Methotrexate, a drug used for treating RECIST Response Evaluation Criteria In Solid
cancer and arthritis. MTX is a chemical analog of folic acid Tumors
NK cell natural killer cell. NK cells can kill target cells by REMS Risk Evaluation and Mitigation Strategy
way of ADCC. In ADCC, an antibody binds to the NK RTF Refuse to File
cell by way of the constant region of the antibody and an RFS relapse-free survival
Fc receptor. Also, the same antibody binds to a target cell RNA ribonucleic acid
by way of its variable region, and a specific antibody on RTOG Radiation Therapy Oncology Group
the target cell. In ADCC, various ligand and receptors, SAE serious adverse event
expressed on the surface of the NK cell and the target SC subcutaneous
cell must be compatible with each other. When the above SNP single nucleotide polymorphism
conditions are met, the NK cell kills the target cell SPA request for Special Protocol Assessment
ABBREVIATIONS AND DEFINITIONS xxix
SVR sustained virological response Th2 Th2 refers to Th2-type helper T cells. Th2 also refers
SWOG Southwest Oncology Group to any Th2-type cytokine, for example, IL-4, IL-5, IL-10,
T cells thymus-derived cells and IL-13, without regard to the cell origin
TDM time to distant metastasis tid “ter in die,” which is Latin for three times a day
TdP Torsade de pointes q3w every three weeks
Th1 Th1 refers to Th1-type helper T cells. Th1 also refers USC; U.S.C. United States Code
to any Th1-type cytokine, for example, IFN-gamma, USPTO United States Patent and Trademark Office
without regard to the cell origin WHO World Health Organization
Biographies

The author received his PhD from the sclerosis, melanoma, head and neck cancer,
University of California at Berkeley in 1980, liver cancer, pancreatic cancer, and hepatitis
and conducted postdoctoral research at C. At an earlier time, he wrote two editions
University of Wisconsin-Madison and also at of Nutritional Biochemistry, published by
U.C. Berkeley. Most of his 20 research publica- Elsevier, Inc. (9). Nutritional Biochemistry
tions concern the enzymology, metabolism, describes the clinical features, diagnosis,
and pharmacokinetics of folates and related treatment, and mechanisms of action of 40
amino acids (1,2,3,4). Also, he cloned, drugs, relating to the metabolic diseases.
sequenced, and expressed an oncogene (XPE More recently, the author acquired 3 years
gene) (5,6,7). Later, he performed research on of experience in FDA regulations, as applied to
the structure of an antibody (natalizumab) package inserts, as well as further experience
used for treating multiple sclerosis (8). The in medical writing in oncology, immune disor-
author has 15 years of pharmaceutical industry ders, and infections, at Baker Hostetler, LLP,
experience, acquired at Schering-Plough, Cerus Costa Mesa, CA. The author has 16 years of
Corporation, and Athena Neurosciences (Elan training and experience in the Code of Federal
Pharmaceuticals), and has contributed to FDA- regulations, as it applies to pharmaceuticals
submissions for the indications of multiple and clinical trial design.
1
Brody T, Stokstad ELR. Folate oligoglutamate:amino acid transpeptidase. J. Biol. Chem. 1982;257:14271 9.
2
Brody T, Watson JE, Stokstad ELR. Folate pentaglutamate and folate hexaglutamate mediated one-carbon
metabolism. Biochemistry 1982;21:276 82.
3
Brody T, Stokstad ELR. Nitrous oxide provokes changes in folylpenta- and hexaglutamates. J. Nutr.
1990;120:71 80.
4
Brody T, Stokstad ELR. Incorporation of the 2-ring carbon of histidine into folylpolyglutamate coenzymes. J. Nutr.
Biochem. 1991;2:492 8.
5
Brody T, Keeney S, Linn S. Human damage-specific DNA binding protein p48 subunit mRNA, GenBank,
Accession # U18299; 1995.
6
Keeney S, Eker AP, Brody T, et al. Correction of the DNA repair defect in xeroderma pigmentosum group E by
injection of a DNA damage-binding protein. Proc. Natl Acad. Sci. 1994;91:4053 6.
7
Dualan R, Brody T, Keeney S, et al. Chromosomal localization and cDNA cloning of the genes (DDB1 and DDB2)
for the p127 and p48 subunits of a human damage-specific DNA binding protein. Genomics 1995;29:62 9.
8
Brody T. Multistep denaturation and hierarchy of disulfide bond cleavage of a monoclonal antibody. Analytical
Biochem. 1997;247:247 56.
9
Brody T. Nutritional biochemistry. 2nd ed. San Diego, CA: Academic Press; 1999.

xxxi
xxxii BIOGRAPHIES

Dr Jennifer A. Elder, PhD, author of Dr Elder served as the lead statistician on


Chapter 10, Biostatistics: Part II, is Chief pivotal studies for various compounds, and
Scientific Officer at PharPoint Research, Inc., in has participated in the completion of several
Durham, NC. Dr Elder has performed statisti- NDA, MAA, sNDA, and IND applications,
cal analyses for clinical trials for 15 years, with and provided strategic consulting, and statisti-
11 of those years being in the CRO industry. cal analysis oversight for over 75 projects.
C H A P T E R

1
Origins of Drugs

I. INTRODUCTION • Drugs identified by screening libraries of


chemicals.
Drugs have a number of origins, as
Some drugs are based on natural products,
outlined:
where the natural products were known to have
• Natural products, for example, chemicals pharmacological effects. The term “natural
from plants and microorganisms. products” is a term of the art that generally
• Analogs of naturally occurring chemicals refers to chemicals derived from plants, fungi,
that reside in various biosynthetic pathways or microorganisms. Drugs that are derived from
of mammals. natural products, or that actually are natural
• Antibodies that bind to naturally occurring products, include warfarin (1), penicillin (2,3),
targets in the body. cyclosporine (4), aspirin (5,6), paclitaxel (7),
• Discovery that an existing drug, established fingolimod (8), and reserpine (9). Many other
as effective for a first disease, is also effective drugs have structures based on chemicals
for treating an unrelated second disease. that occur naturally in the human body, that

1
Wardrop D, Keeling D. The story of the discovery of heparin and warfarin. Br. J. Haematol. 2008;141:75763.
2
Diggins FW. The true history of the discovery of penicillin, with refutation of the misinformation in the literature.
Br. J. Biomed. Sci. 1999;56:8393.
3
Fleming A. On the antibacterial action of cultures of a penicillium, with special reference to their use in the
isolation of B. influenzae. 1929. Bull. World Health Organ. 2001;79:78090.
4
Heusler K, Pletscher A. The controversial early history of cyclosporin. Swiss Med. Wkly 2001;131:299302.
5
Lafont O. From the willow to aspirin. Rev. Hist. Pharm. (Paris) 2007;55:20916.
6
Mahdi JG, Mahdi AJ, Mahdi AJ, Bowen ID. The historical analysis of aspirin discovery, its relation to the willow
tree and antiproliferative and anticancer potential. Cell Prolif. 2006;39:14755.
7
Socinski MA. Single-agent paclitaxel in the treatment of advanced non-small cell lung cancer. Oncologist
1999;4:40816.
8
Adachi K, Chiba K. FTY720 story. Its discovery and the following accelerated development of sphingosine 1-
phosphate receptor agonists as immunomodulators based on reverse pharmacology. Perspect. Medicin. Chem.
2007;1:1123.
9
Rao EV. Drug discovery from plants. Curr. Sci. 2007;93:1060.

Clinical Trials.
DOI: http://dx.doi.org/10.1016/B978-0-12-804217-5.00001-1 1 © 2016 Elsevier Inc. All rights reserved.
2 1. ORIGINS OF DRUGS

is, where the drugs are analogs of these chemi- a prediction of pharmacokinetics of the drug
cals. These include analogs of intermediates or and pathways of metabolism, transport, and
final products of biosynthetic pathways. Drugs excretion. Fourth, the structure of the drug
that are analogs of chemicals in biosynthetic can help the investigator predict adverse
pathways include methotrexate, cladribine, and events that might be expected from the drug.
ribavirin. For example, if the drug belongs to a class of
Still other drugs originated by first identifying compounds that activates cytochrome P450,
a target cell, or target protein, and then by some of the adverse events can be predicted.
preparing antibodies that bind to that target. Fifth, regulatory submissions to the US Food
Vaccines have a similar origin. Once a target and Drug Administration (FDA), such as the
protein is identified, this target protein (or a Investigational New Drug (IND), Investigator’s
derivative of it) can be formulated as a vaccine. Brochure, and the package insert, typically con-
Typically, vaccines take the form of the target tain a drawing of the drug structure.
protein derivative, called an “antigen,” in combi-
nation with a second compound that is an
immune adjuvant. a. Origin of Warfarin
Drugs are also derived using a screening Warfarin is a drug that is widely used to
assay and by testing hundreds or thousands prevent blood clotting, for example, in people
of purified candidate compounds using that at risk of heart attacks or strokes (10). A natu-
assay. Where the screening method is auto- ral product produced during the spoiling of
mated, the method is called high-throughput sweet clover inspired warfarin’s design. The
screening. The screening assay may consist of drug was not named after any kind of warfare,
tumor cells that are cultured in vitro, where a even though it is used in warfare against mice
robot determines if the candidate drug inhibits and rats; it was named after the Wisconsin
a particular enzyme in the tumor cell or if Alumni Research Foundation.
the candidate drug kills the tumor cell. Spoiled sweet clover contains coumarin, a
compound that inhibits an enzyme in the
liver, where the end-result is impaired blood
II. STRUCTURES OF DRUGS clotting. Blood clotting factors are biosynthe-
sized in the liver, and then released into
A knowledge of the structure of a drug to the bloodstream. Farmers in the mid-West
be used in a clinical trial is needed for the found that cattle bled to death during the
following reasons. First, the issue of whether process of de-horning, where the cattle had
a drug is hydrophobic or hydrophilic will eaten spoiled sweet clover. Eventually, one
dictate the nature of the excipient. If a drug is particular farmer in Wisconsin took a bucket of
not water-soluble, then the excipient might unclotted blood to researchers at the University
need to include a solubilizing agent, such as a of Wisconsin. The researchers examined the
solvent. Second, the structure can also provide blood, as well as samples of spoiled sweet
an idea of stability during long-term storage clover, and discovered that the culprit was
and thus in need of protection from light or in dicoumarol, a degradative product of couma-
need of cold storage. Third, the structure can rin. Researchers synthesized and tested about
dictate the route of administration, and enable 50 analogs of this compound. The analogs were
10
Yeh CH, et al. Evolving use of new oral anticoagulants for treatment of venous thromboembolism. Blood
124:10208.

CLINICAL TRIALS
II. STRUCTURES OF DRUGS 3
tested in rabbits. It was discovered that the analog of folic acid, inhibits dihydrofolic acid
best analog was warfarin (11). Warfarin is also reductase. Another antifolate drug used in
the active ingredient in rodent poison. oncology is 5-fluorouracil. Fluorouracil was
invented by Charles Heidelberger (17,18). The
O O
drug was developed on the basis of findings
in the 1950s that cancer cells incorporated
a larger amount of the uracil base into the
DNA than normal cells. In testing a number
OH O of halogen-substituted uracil compounds, 5-
fluorouracil appeared to be the most active
and promising drug. Fluorouracil is a suicide
inhibitor of thymidylate synthase. This means
Warfarin that the enzyme’s own catalytic activity
results in the activation of the drug, where
this activation causes the drug to react cova-
lently with the enzyme, thereby destroying
b. Origins of Methotrexate
the enzyme’s catalytic activity.
and 5-Fluorouracil
H2N N N
The natural substrate of one particular
enzyme, dihydrofolate reductase, inspired the N N
design of methotrexate. This natural substrate N O
is dihydrofolic acid (12). Dihydrofolic acid is the H
NH2 N
OH
end-product of the biosynthetic pathway of
folates (13). Anticancer drugs that inhibit dihy- O
drofolate reductase were designed by synthe-
sizing and screening chemicals that resembled O OH
dihydrofolate (14,15,16). Methotrexate, which Methotrexate
is an analog of dihydrofolic acid, and also an

11
Link KP. The discovery of dicumarol and its sequels. Circulation 1959;19:97107.
12
Folic acid is used as a vitamin supplement and for enzymatic studies of dihydrofolic acid reductase. But folic
acid is not a naturally occurring chemical. Folic acid is formed during the breakdown of dihydrofolic acid, upon
exposure to oxygen. Dihydrofolic acid is a natural product made by microorganisms and plants.
13
Brown GM, Williamson JM. Biosynthesis of riboflavin, folic acid, thiamine, and pantothenic acid. Adv. Enzymol.
Relat. Areas Mol. Biol. 1982;53:34581.
14
Friedkin M. Enzymatic aspects of folic acid. Annu. Rev. Biochem. 1963;32:185214.
15
Bertino JR. The mechanism of action of folate antagonists in man. Cancer Res. 1963;23:1286306.
16
Brody T. Folic acid. In: Machlin LJ, editor. Handbook of vitamins. New York: Marcel Dekker, Inc.; 1990. p. 45389.
17
Muggia FM, Peters GJ, Landolph Jr JR. XIII International Charles Heidelberger Symposium and 50 years of
fluoropyrimidines in cancer therapy held on September 6 to 8, 2007 at New York University Cancer Institute,
Smilow Conference Center. Mol. Cancer Ther. 2009;8:9929.
18
Heidelberger C. On the rational development of a new drug: the example of the fluorinated pyrimidines. Cancer
Treat. Rep. 1981;65(Suppl. 3):39.

CLINICAL TRIALS
4 1. ORIGINS OF DRUGS

c. Origin of Ribavirin O

Ribavirin was discovered by synthesizing NH2


N
analogs of a compound participating in the N
pathways of nucleotide biosynthesis. In design- HO N
ing, synthesizing, and testing a variety of ana- O
logs of intermediates in nucleotide biosynthetic
pathways, the result was the discovery of
ribavirin, also known as virazole (19,20).
OH OH
Ribavirin, in combination with one or
Ribavirin
more drugs, is used to treat HCV infections
(21,22,23,24,25,26,27,28,29). The other drugs in
this combination include sofosbuvir, dasabuvir,
and pegylated interferon-alfa. Ribavirin alone
has been used to treat hepatitis E virus (30).

19
Witkowski JT, Robins RK, Sidwell RW, Simon LN. Design, synthesis, and broad spectrum antiviral activity of
1-beta-D-ribofuranosyl-1,2,4-triazole-3-carboxamide and related nucleosides. J. Med. Chem. 1972;15:11504.
20
Te HS, Randall G, Jensen DM. Mechanism of action of ribavirin in the treatment of chronic hepatitis C.
Gastroenterol. Hepatol. 2007;3:21825.
21
Feld JJ, Kowdley KV, Coakley E, et al. Treatment of HCV with ABT-450/r-ombitasvir and dasabuvir with
ribavirin. New Engl. J. Med. 2014;370:1594603.
22
Kwo PY, Mantry PS, Coakley E, et al. An interferon-free antiviral regimen for HCV after liver transplantation.
New Engl. J. Med. 2014;371:237582.
23
Zeuzem S, Dusheiko GM, Salupere R, et al. Sofosbuvir and ribavirin in HCV genotypes 2 and 3. New Engl. J.
Med. 2014;370:19932001.
24
Afdhal N, Zeuzem S, Kwo P, et al. Ledipasvir and sofosbuvir for untreated HCV genotype 1 infection. New
Engl. J. Med. 2014;370:188998.
25
Ferenci P, Bernstein D, Lalezari J, et al. ABT-450/r-ombitasvir and dasabuvir with or without ribavirin for HCV.
New Engl. J. Med. 2014;370:198392.
26
Gane EJ, Stedman CA, Hyland RH, et al. Nucleotide polymerase inhibitor sofosbuvir plus ribavirin for hepatitis
C. New Engl. J. Med. 2013;368:3444.
27
Kamar N, Izopet J, Tripon S, et al. Ribavirin for chronic hepatitis E virus infection in transplant recipients. New
Engl. J. Med. 2014;370:111120.
28
Lawitz E, Mangia A, Wyles D, et al. Sofosbuvir for previously untreated chronic hepatitis C infection. New Engl.
J. Med. 2013;368:187887.
29
Rodriguez-Torres M, Jeffers LJ, Sheikh MY, et al. Peginterferon alfa-2a and ribavirin in Latino and non-Latino
whites with hepatitis C. New Engl. J. Med. 2009;360:25767.
30
Zeuzem S, Soriano V, Asselah T, et al. Faldaprevir and deleobuvir for HCV genotype 1 infection. New Engl. J.
Med. 2013;369:6309.

CLINICAL TRIALS
II. STRUCTURES OF DRUGS 5

d. Origin of Paclitaxel O

Paclitaxel (Taxols), an anticancer drug, H 2C O


O OH
O CH2
was discovered in extracts of the Pacific yew
tree, Taxus brevifolia. In 1963, a crude extract H H 2C
N CH2
from Pacific yew bark was found to have O
O
H2C
activity against tumors in experimental ani-
O H
mals (31). In 1991, the active component, pac- OH O O
CH2
litaxel, was approved by the FDA as an OH O
anticancer drug. Paclitaxel, which is a class of O
drugs called taxanes, acts on the cytoskeleton
of the cell. Specifically, the drug acts on tubu-
Paclitaxel
lin, disrupts the normal behavior of the cyto-
skeleton in mediating cell division, and e. Origin of Cladribine
causes cell death (32). Docetaxel (Taxoteres)
is a semisynthetic analog of paclitaxel (33) Cladribine (2-chloro-20 -deoxyadenosine) is a
having a mechanism and anticancer proper- small molecule that is a nucleotide analog.
ties similar to those of paclitaxel. Docetaxel Cladribine is an analog of deoxyadenosine.
can be synthesized using a precursor After administration, cladribine enters various
extracted from needles of the European cells and once inside the cell, the enzyme deoxy-
yew, Taxus baccata (34). Paclitaxel finds use in cytidine kinase catalyzes the attachment of three
treating various cancers, in a formulation phosphate groups. The result is the conversion
where paclitaxel is bound to albumin of cladribine to cladribine triphosphate.
(35,36,37). The albumin confers water- Cladribine triphosphate, in turn, inhibits DNA
solubility to paclitaxel, which is not soluble in synthesis, inhibits DNA repair, and results in
water. apoptosis (death of the cell). The drug is most

31
Socinski MA. Single-agent paclitaxel in the treatment of advanced non-small cell lung cancer. Oncologist
1999;4:40816.
32
Pusztai L. Markers predicting clinical benefit in breast cancer from microtubule-targeting agents. Ann. Oncol.
2007;18(Suppl. 12):xii1520.
33
Bissery MC, Guénard D, Guéritte-Voegelein F, Lavelle F. Experimental antitumor activity of taxotere (RP 56976,
NSC 628503), a taxol analogue. Cancer Res. 1991;51:484552.
34
Verweij J. Docetaxel (Taxotere): a new anti-cancer drug with promising potential? Br. J. Cancer 1994;70:1834.
35
Socinski MA. Update on taxanes in the first-line treatment of advanced non-small-cell lung cancer. Curr. Oncol.
2014;21:e691703.
36
Socinski MA, et al. Weekly nab-paclitaxel in combination with carboplatin versus solvent-based paclitaxel plus
carboplatin as first-line therapy in patients with advanced non-small-cell lung cancer: final results of a phase III
trial. J. Clin. Oncol. 2012;30:205562.
37
Viudez A, et al. Nab-paclitaxel: a flattering facelift. Crit. Rev. Oncol. Hematol. 2014;92:166-80.

CLINICAL TRIALS
6 1. ORIGINS OF DRUGS

active in cells with high levels of deoxycytidine adenosine deaminase. Cladribine naturally resists
kinase, such as lymphocytes (38,39). Cladribine deamination catalyzed by adenosine deaminase.
is used to treat multiple sclerosis and a type of (For cladribine to be effective in destroying
leukemia (hairy cell leukemia) (40). lymphocytes, it is not necessary that patients be
The connection between deoxynucleotides suffering from adenosine deaminase deficiency.)
and killing lymphocytes, as it applies to Just as the normally occurring deoxyadenosine
cladribine, is as follows. Inherited deficiencies kills lymphocytes in people with the genetic dis-
of the enzyme adenosine deaminase interfere ease adenosine deaminase deficiency, cladribine
with lymphocyte development while sparing kills lymphocytes when administered to normal
most other organ systems (41). The accumula- humans (43). It was about 10 years after the use of
tion of deoxyadenosine nucleotides in the lym- cladribine to treat leukemia that cladribine was
phocytes, that is, in lymphocytes of people first used to treat multiple sclerosis (44,45).
suffering from adenosine deaminase defi- This summarizes the pathway of the discov-
ciency, reduces the number of lymphocytes. ery of cladribine for multiple sclerosis. First, it
As a consequence, the patients suffer from was known that an inherited genetic disease
severe immunodeficiency. involved the accumulation of deoxyadenosine
Carson et al. (42) realized that the elimina- nucleotides in the cell, and resulted in death of
tion of adenosine deamidase activity can halt lymphocytes. Second, researchers developed a
lymphocytes that are pathological, such as the drug that, when administered to a human
lymphocytes in leukemia (leukemia is a cancer subject, mimicked the effects of this disease
of lymphocytes). This elimination was accom- (due to the inability of adenosine deaminase
plished by cladribine. Cladribine, in effect, mimics to act on the drug). Third, the drug was used to
the inherited disease (adenosine deaminase treat leukemia. Fourth, the drug was used
deficiency) because cladribine resists the effects of to treat multiple sclerosis (46).

38
Klanova M, Lorkova L, Vit O, et al. Downregulation of deoxycytidine kinase in cytarabine-resistant mantle cell
lymphoma cells confers cross-resistance to nucleoside analogs gemcitabine, fludarabine and cladribine, but not to
other classes of anti-lymphoma agents. Mol. Cancer 2014;13:159 (14 pp.).
39
Piro LD, Carrera CJ, Beutler E, Carson DA. 2-Chlorodeoxyadenosine: an effective new agent for the treatment of
chronic lymphocytic leukemia. Blood 1988;72:106973.
40
Rosenburg JD. Clinical characteristics and long-term outcome of young hairy cell leukemia patients treated with
cladribine: a single-institution series. Blood 2014;123:17783.
41
Carson DA, Kaye J, Seegmiller JE. Lymphospecific toxicity in adenosine deaminase deficiency and purine
nucleoside phosphorylase deficiency: possible role of nucleoside kinase(s). Proc. Natl Acad. Sci. USA
1977;74:567781.
42
Carson DA, Wasson DB, Taetle R, Yu A. Specific toxicity of 2-chlorodeoxyadenosine toward resting and
proliferating human lymphocytes. Blood 1983;62:73743.
43
Piro LD, Carrera CJ, Beutler E, Carson DA. 2-Chlorodeoxyadenosine: an effective new agent for the treatment of
chronic lymphocytic leukemia. Blood 1988;72:106973.
44
Sipe JC, Romine JS, Koziol JA, McMillan R, Zyroff J, Beutler E. Cladribine in treatment of chronic progressive
multiple sclerosis. Lancet 1994;344:913.
45
Beutler E, Koziol JA, McMillan R, Sipe JC, Romine JS, Carrera CJ. Marrow suppression produced by repeated
doses of cladribine. Acta Haematol. 1994;91:1015.
46
Giovannoni G, Comi G, Cook S, et al. A placebo-controlled trial of oral cladribine for relapsing multiple
sclerosis. New Engl. J. Med. 2010;362:41626.

CLINICAL TRIALS
II. STRUCTURES OF DRUGS 7
NH2 Developing antibody drugs includes the
step of refining the polypeptide sequence
N
N of the antibody into a drug suitable for
administering to humans (50,51,52). This refine-
HO N CI ment step is called humanization (53).
N
O Humanization refers to the process of using
genetic engineering to convert any protein of
animal origin to a protein that can be injected
into people, where the injected protein fails to
OH H elicit an immune reaction against itself.
Antibodies take the form of four polypep-
tides, two light chains and two heavy chains,
as indicated in the diagram below. The first
f. Origins of Therapeutic Antibodies light chain and first heavy chain are covalently
attached to each other by disulfide bonds,
Antibodies designed with the aid of animal to form a first complex. The second light
models are used to treat various cancers chain and second heavy chain are covalently
and immune diseases. For example, antibody attached to each by disulfide bonds to form a
drugs include trastuzumab (Herceptins) (47), second complex. The first complex and second
which binds to epidermal growth factor, and complex are also covalently attached to each
which is used to treat breast cancer. Antibody other by way of disulfide bonds.
drugs also include bevacizumab (Avastins)
(48), which binds to vascular endothelial growth Light chain
factor receptor (VEGFR), and is used to treat a
variety of cancers. Moreover, an antibody drug Heavy chain

used to treat various immune diseases is natali-


zumab (Tysabris) (49). This antibody binds to a Heavy chain
protein called integrin, which occurs on the sur-
face of white blood cells. Natalizumab is used to
treat two autoimmune diseases, multiple sclero- Light chain

sis and Crohn’s disease.


47
Verma S, Lavasani S, Mackey J, et al. Optimizing the management of her2-positive early breast cancer: the
clinical reality. Curr. Oncol. 2010;17:2033.
48
Eskens FA, Sleijfer S. The use of bevacizumab in colorectal, lung, breast, renal and ovarian cancer: where does it
fit? Eur. J. Cancer 2008;44:23506.
49
Coyle PK. The role of natalizumab in the treatment of multiple sclerosis. Am. J. Manag. Care 2010;16(6 Suppl.):
S16470.
50
Kent SJ, Karlik SJ, Cannon C, et al. A monoclonal antibody to alpha 4 integrin suppresses and reverses active
experimental allergic encephalomyelitis. J. Neuroimmunol. 1995;58:110.
51
Yednock TA, Cannon C, Fritz LC, et al. Prevention of experimental autoimmune encephalomyelitis by antibodies
against alpha 4 beta 1 integrin. Nature 1992;356:636.
52
Brody T. Multistep denaturation and hierarchy of disulfide bond cleavage of a monoclonal antibody. Analyt.
Biochem. 1997;247:24756.
53
Presta LG. Molecular engineering and design of therapeutic antibodies. Curr. Opin. Immunol. 2008;20:46070.

CLINICAL TRIALS
8 1. ORIGINS OF DRUGS

As an example of an antibody drug, the The three-dimensional structure of this anti-


amino acid sequence of the light chain and the body drug can be found at: www.drugbank.
amino acid sequence of the heavy chain of ca/drugs/DB00072
trastuzumab are shown below (54). Let us dwell on the structure of the light
The amino acid sequence of the light chain chain and heavy chain for a moment. In testing
of trastuzumab, as found at the cited accession and marketing any polypeptide drug, pharma-
numbers (55,56), is shown below. The light ceutical companies are concerned with the fol-
chain, shown below, has 214 amino acids. lowing drug stability issues. First, it is the case
that long-term storage of polypeptides results
DIQ MTQSPSSLSASVGDRVTITCR ASQDVNT in the spontaneous deamination of residues of
AVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGS glutamine (Q) and asparagine (N). Deamination
RSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFG can occur at various steps in the manufacturing
QGTKVEIKRTVAAPSFIFPPSDEQLKSGTASVVC
LLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS process, during shipment, and during storage.
KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS Also, oxidation of cysteine (C) residues can
SPVTKSFNRGEC occur during manufacturing, shipping, and
storage. These types of damage may lower the
The amino acid sequence of the heavy chain potency of polypeptide drugs. The reader will
of this antibody, which has 451 amino acids be able to find the locations of Q, N, and C, in
and can be found at the cited accession num- the polypeptide chains of trastuzumab.
ber (57), is shown below.

EVQLVESGGGLVQPGGSLRLSCA ASGFNIKD III. THE 20 CLASSICAL


TYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVK AMINO ACIDS
GRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW
GGDGFYA M DYW GQGTLVTVSSASTKG PSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL
This reviews the 20 classical amino acids
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT (Table 1.1). Twenty classical amino acids exist,
YICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCP and these are listed, along with their abbrevia-
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV tions in Table 1.1. The nonclassical amino acids
DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS include homocysteine, selenocysteine (58),
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI
EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT
methionine sulfoxide, ornithine, gamma-
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS carboxyglutamate (GLA) (59), phosphotyrosine,
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN hydroxyproline (60), sarcosine, and betaine. A
HYTQKSLSLSPGK protein is a long polypeptide that is a linear

54
Fong S, Hu Z. Therapeutic anti-HER2 antibody fusion polypeptides. U.S. Pat. Appl. Publ. 2009/0226466; 2009.
September 10.
55
Cho HS, Mason K, Ramyar KX, et al. GenBank Accession No. PDB:1N8Z_A (submitted November 21, 2002).
56
http://www.drugbank.ca/drugs/DB00072
57
Trastuzumab (DB00072) DrugBank Accession No. DB0072. Creation date June 13, 2005, updated June 2, 2009.
58
Brody T. Nutritional biochemistry. 2nd ed. San Diego, CA: Academic Press; 1999. p. 21 and 8257.
59
Brody T, Suttie JW. Evidence for the glycoprotein nature of vitamin K-dependent carboxylase from rat liver.
Biochim. Biophys. Acta 1987;923:17.
60
Brody T. Nutritional biochemistry. 2nd ed. San Diego, CA: Academic Press; 1999. p. 21 and 61923.

CLINICAL TRIALS
III. THE 20 CLASSICAL AMINO ACIDS 9
polymer of amino acids, typically about
TABLE 1.1 The 20 Classical Amino Acids 100500 amino acids in length. The term oligo-
peptide refers to shorter polymers of amino
One-Letter Three-Letter
Amino Acid Abbreviation Abbreviation acids in the range of about 1050 amino acids.
Some nonclassical amino acids, such as homo-
AMINO ACIDS WITH CHARGED SIDE GROUP cysteine, exist only in the free state, and do
Glutamic acid E Glu not become incorporated into any polypep-
Aspartic acid D Asp
tide. But other nonclassical amino acids, such
as GLA and phosphotyrosine, occur in natu-
Lysine K Lys rally occurring proteins because of a process
Histidine H His called post-translational modification.
Arginine R Arg
Table 1.1 identifies which amino acids have
a side chain that is charged, and thus interact
Asparagine N Asn well with water, and amino acids with an
Glutamine Q Gln uncharged side chain, and thus do not much
AMINO ACIDS WITH LIPOPHILIC (HYDROPHOBIC)
interact with water. The terms hydrophilic and
SIDE CHAIN hydrophobic are used to refer to chemicals, or
to regions of chemicals, that are charged and
Phenylalanine F Phe
that are uncharged, respectively. Hydrophilic
Tyrosine Y Tyr groups include carboxyl groups, amino
Leucine L Leu groups, and hydroxyl groups. Hydrophobic
groups include alkane chains and aromatic
Isoleucine I Ileu
rings. Although the term “hydrophobic” is in
Valine V Val common use, it has been pointed out that
Tryptophan W Trp there does not exist any force or interaction
in nature that is a hydrophobic force or
AMINO ACID WITH HYDROXYL GROUP
interaction (61).
Serine S Ser A knowledge of the amino acids is needed
Threonine T Thr to understand:
AMINO ACIDS WITH SULFUR ATOM • drug stability during manufacturing and
Cysteine C Cys
storage,
• point of attachment of polyethylene glycol
Methionine M Met (PEG) to the drug, where relevant,
OTHER AMINO ACIDS • unwanted immunogenicity,
Glycine G Gly
• immunogenicity that is desired and
essential for drug efficacy.
Alanine A Ala
This concerns in vitro stability. For drugs
Proline P Pro
that are oligopeptides or proteins, stability

61
Hildebrand JH. Is there a “hydrophobic effect”? Proc. Natl Acad. Sci. 1979;76:194.

CLINICAL TRIALS
10 1. ORIGINS OF DRUGS

during manufacturing and storage is an For drugs that are antibodies, enzymes,
issue because of spontaneous deamidation. cytokines, and hormones, what is desired
Aswad and coworkers have detailed the is that the drug not be immunogenic. In
deamidation of biologicals (62,63). The stabil- striking contrast, for drugs that are vaccines,
ity of proteins can also be compromised what is desired and essential, is that the drug
by degradation catalyzed by contaminating stimulate a vigorous immunogenic response.
proteases and by the related issue of A knowledge of the amino acids is needed
aggregation (64,65,66). Proteases can occur as for understanding all of the above issues.
contaminants during the drug-manufacturing Undesired immunogenicity arises where the
process, and proteases also occur in the drug takes the form of extract from a tissue
human body. Polyethylene glycol can be or organ from an animal, or where the drug
connected to recombinant enzymes and takes the form of a recombinant version
cytokines to enhance the stability and life- of an animal protein. Undesired immunoge-
time of the drug in the bloodstream. nicity can be reduced or eliminated by the
Polypeptide drugs that are modified in this process of “humanization,” where the genetic
way are called, pegylated polypeptides engineer alters the primary sequence of
(67,68,69), where the polyethylene glycol can the animal protein so that it matches the pri-
be attached to residues of lysine or arginine mary sequence of the corresponding human
(70,71,72). protein (73).

62
Paranandi MV, Guzzetta AW, Hancock WS, Aswad DW. Deamidation and isoaspartate formation during
in vitro aging of recombinant tissue plasminogen activator. J. Biol. Chem. 1994;269:24353.
63
Aswad DW, Paranandi MV, Schurter BT. Isoaspartate in peptides and proteins: formation, significance, and
analysis. J. Pharm. Biomed. Anal. 2000;21:112936.
64
Simpson RJ. Stabilization of proteins for storage. Cold Spring Harb. Protocol. 2010;2010(5).
65
O’Fágáin C. Storage and lyophilisation of pure proteins. Methods Mol. Biol. 2011;681:179202.
66
Chi EY, Krishnan S, Randolph TW, Carpenter JF. Physical stability of proteins in aqueous solution: mechanism
and driving forces in nonnative protein aggregation. Pharm. Res. 2003;20:132536.
67
Ramos EL. Preclinical and clinical development of pegylated interferon-lambda 1 in chronic hepatitis C. J.
Interferon Cytokine Res. 2010;30:5915.
68
Hershfield MS, Roberts LJ II, Ganson NJ, et al. Treating gout with pegloticase, a PEGylated urate oxidase, provides
insight into the importance of uric acid as an antioxidant in vivo. Proc. Natl Acad. Sci. USA 2010;107:143516.
69
Fishburn CS. The pharmacology of PEGylation: balancing PD with PK to generate novel therapeutics. J. Pharm. Sci.
2008;97:416783.
70
Lee H, Park TG. Preparation and characterization of mono-PEGylated epidermal growth factor: evaluation of
in vitro biologic activity. Pharm. Res. 2002;19:84551.
71
Veronese F, Sartore L, Orsolini P, Deghenghi R. U.S. Pat. No. 5,286,637.
72
Gauthier MA, Klok HA. Arginine-specific modification of proteins with polyethylene glycol. Biomacromolecules
2011;12:48293.
73
Kuramochi T, et al. Humanization and simultaneous optimization of monoclonal antibody. Methods Mol. Biol.
2014;1060:12337.

CLINICAL TRIALS
IV. ANIMAL MODELS 11

IV. ANIMAL MODELS animal disease with mechanisms of a human


disease, data on efficacy can only be acquired
a. Introduction to Animal Models where there is an available animal model of the
of Human Diseases disorder in question. Where the goal of the drug
is to enhance wound healing, it is easy to find a
Animals are used for studying the biochem- suitable animal model (all that is needed is to
istry, molecular biology, and genetics of vari- surgically remove a circle of skin from
ous diseases, that is, the disease mechanism. the animal). However, where the goal of the
Once a suitable animal has been found where drug is to treat diseases such as cancer, immune
the mechanism is similar to that of a corre- diseases, or infections, there is a need to find an
sponding disease in humans, that particular appropriate animal model. Brody (74)
animal may be used as an animal model for describes animal models for various diseases,
testing efficacy of candidate drugs. For oncol- and reveals the criteria needed for an animal
ogy, animal models are typically injected with model to predict the efficacy of a drug for the
tumor cells. For immune disorders, animals are disease in humans.
administered an agent that provokes inflamma- While rodents spontaneously develop various
tion. And for infections, animals are exposed to cancers, it is not practical to acquire a group of
the relevant microorganism or virus. rodents with the same type of cancer, and at the
For these reasons, animal models are same stage of the cancer, at the same time. The
described in this chapter. For the sake of conti- variety of tumors that occurs spontaneously in
nuity, what is also included are specialized rats has been exhaustively documented (75,76).
topics on animals, such as validation, the Separate animal models are available for
Animal Rule, and use of animal data to arrive various types of cancer. Marks (77) identified
at doses for humans. sources of various animal cancer models.
Regulatory approval for drugs requires data Nandan and Yang (78), Kuperwasser et al.
on safety and efficacy in animals. While data on (79), Soda et al. (80), and Noonan et al. (81), dis-
safety can be acquired from studies on mice, cuss animal models for colorectal cancer, breast
rats, rabbits, dogs, and primates, with little or no cancer, nonsmall-cell lung cancer, and mela-
need for correspondence of mechanisms of an noma, respectively.

74
Brody T. Enabling claims under 35 USC y112 to methods of medical treatment or diagnosis, based on in vitro cell
culture models and animal models. J. Patent Trademark Office Soc. 2015;97:328411.
75
Son WC, Bell D, Taylor I, Mowat V. Profile of early occurring spontaneous tumors in Han Wistar rats. Toxicol.
Pathol. 2010;38:2926.
76
Bomhard E. Frequency of spontaneous tumors in Wistar rats in 30-months studies. Exp. Toxicol. Pathol. 1992;44:38192.
77
Marks C. Mouse Models of Human Cancers Consortium (MMHCC) from the NCI. Dis. Model Mech. 2009;2:111.
78
Nandan MO, Yang VW. Genetic and chemical models of colorectal cancer in mice. Curr. Colorectal Cancer Rep.
2010;6:519.
79
Kuperwasser C, Dessain S, Bierbaum BE, et al. A mouse model of human breast cancer metastasis to human
bone. Cancer Res. 2005;65:61308.
80
Soda M, Takada S, Takeuchi K, et al. A mouse model for EML4-ALK-positive lung cancer. Proc. Natl Acad. Sci.
USA 2008;105:198937.
81
Noonan FP, Dudek J, Merlino G, De Fabo EC. Animal models of melanoma: an HGF/SF transgenic mouse
model may facilitate experimental access to UV initiating events. Pigment Cell Res. 2003;16:1625.

CLINICAL TRIALS
12 1. ORIGINS OF DRUGS

Similarly, animal models for certain infections and differences. Researchers conducting animal
are available. Animal models for infectious dis- models on diseases with an immune compo-
eases include the woodchuck (82), which is the nent, that is, cancer, autoimmune diseases, and
animal model of choice for hepatitis B virus, the inflammatory disorders, need to be aware of
chimpanzee (83), which is an appropriate large- similarities and differences in the immune
animal model for HCV, and the armadillo (84), systems between their animal and humans. For
which is the animal model for Mycobacterium example, comparisons between mouse and
leprae, the cause of leprosy (Hansen’s disease). human dendritic cells (86), T cells (87), B cells
A suitable small-animal model for hepatitis C (88), NK cells (89), macrophages (90), eosino-
infections has not yet been found. phils (91), and toll-like receptors (TLRs) (92),
In proposing and using animal models for are available.
disorders that have an immune component, it Animal models for immune disorders include
is useful to be aware of the similarities (and dif- the following. A rodent model for multiple scle-
ferences) between the mouse immune system rosis, called EAE (93), involves injecting animals
and the human immune system. Mestas and with myelin basic protein (94). A mouse model
Hughes (85) outline some of these similarities for rheumatoid arthritis involves injecting

82
Menne S, Cote PJ. The woodchuck as an animal model for pathogenesis and therapy of chronic hepatitis B virus
infection. World J. Gastroenterol. 2007;13:10424.
83
Bukh J, Thimme R, Meunier JC, et al. Previously infected chimpanzees are not consistently protected against
reinfection or persistent infection after reexposure to the identical hepatitis C virus strain. J. Virol. 2008;82:818395.
84
Hamilton HK, Levis WR, Martiniuk F, Cabrera A, Wolf J. The role of the armadillo and sooty mangabey monkey
in human leprosy. Int. J. Dermatol. 2008;47:54550.
85
Mestas J, Hughes CC. Of mice and not men: differences between mouse and human immunology. J. Immunol.
2004;172:27318.
86
Boonstra A, Asselin-Paturel C, Gilliet M, et al. Flexibility of mouse classical and plasmacytoid-derived dendritic
cells in directing T helper type 1 and 2 cell development: dependency on antigen dose and differential toll-like
receptor ligation. J. Exp. Med. 2003;197:1019.
87
Walzer T, Arpin C, Beloeil L, Marvel J. Differential in vivo persistence of two subsets of memory phenotype CD8
T cells defined by CD44 and CD122 expression levels. J. Immunol. 2002;168:270411.
88
Frasca D, Landin AM, Riley RL, Blomberg BB. Mechanisms for decreased function of B cells in aged mice and
humans. J. Immunol. 2008;180:27416.
89
Ehrlich LI, Ogasawara K, Hamerman JA, et al. Engagement of NKG2D by cognate ligand or antibody alone is
insufficient to mediate costimulation of human and mouse CD8 1 T cells. J. Immunol. 2005;174:192231.
90
Sunderkötter C, Nikolic T, Dillon MJ, et al. Subpopulations of mouse blood monocytes differ in maturation stage
and inflammatory response. J. Immunol. 2004;172:44107.
91
Dyer KD, Percopo CM, Xie Z, Yang Z, et al. Mouse and human eosinophils degranulate in response to platelet-
activating factor (PAF) and lysoPAF via a PAF-receptor-independent mechanism: evidence for a novel receptor. J.
Immunol. 2010;184:632734.
92
Janssens S, Beyaert R. Role of Toll-like receptors in pathogen recognition. Clin. Microbiol. Rev. 2003;16:63746.
93
Mix E, Meyer-Rienecker H, Zettl UK. Animal models of multiple sclerosis for the development and validation of
novel therapies—potential and limitations. J. Neurol. 2008;255(Suppl. 6):714.
94
Zaller DM, Osman G, Kanagawa O, Hood L. Prevention and treatment of murine experimental allergic
encephalomyelitis with T cell receptor V beta-specific antibodies. J. Exp. Med. 1990;171:194355.

CLINICAL TRIALS
IV. ANIMAL MODELS 13
collagen (95). A mouse model for inflammatory conducting animal studies in compliance with
bowel disease employs a strain of mice that nat- GLP. GLP governs many laboratory practices
urally develops inflammation of the intestinal in addition to those involving animals. The
tract (96). Psoriasis (97), lupus (98), asthma (99), following comments also disclose adverse con-
and other immune disorders also have well- sequences to a Sponsor, where the Sponsor’s
characterized animal models. use of animals fails to comply with various
FDA regulations, as set forth by 21 CFR y58
and by GLP.
b. FDA Regulations and Animal Models
Animal models are used to provide data
on safety and efficacy, where the data are
included in various FDA submissions. Relevant
c. Disease Mechanisms
issues include: An animal model may be ideally suited for
determining the mechanism of a disease, and
• disease mechanisms,
for the screening of candidate drugs, but may
• validation,
be inappropriate and ill-suited for determining
• good laboratory practice (GLP),
efficacy or safety of a particular type of ther-
• animal rule.
apy for that disease. The fruitfly is one type of
Animals are used in the following situa- an animal model that is not likely to be
tions. The first is for discovering the mechan- accepted by the FDA, for convincing the FDA
isms of a disease. Second, animals are used for of a drug’s efficacy and safety. The proven
discovering the mechanisms of drug action utility of the fruitfly model is as follows.
(with or without regard to any disease). In According to Poidevin et al. (101), the fruitfly
other words, the ability of the anticancer drug Drosophila melanogaster is:
ibrutinib to inhibit Bruton’s tyrosine kinase can
be studied in noncancerous cells, as well as in a premiere model system for the study of human
cancer cells (100). Third, the issue of animals neurodegenerative diseases, due to the realization
arises when there is a need to develop a that flies and humans share many structurally and
functionally related gene families. Development of
suitable animal model for a disease. Fourth, such disease models in the fly allows . . . the existing
the issue of animals occurs in the validation fruit fly models of human neurological disorders to
of an existing animal model for a disease. identify small-molecule leads that could potentially
And fifth, the issue of animals occurs when be further developed for therapeutic use.

95
Cho YG, Cho ML, Min SY, Kim HY. Type II collagen autoimmunity in a mouse model of human rheumatoid
arthritis. Autoimmun. Rev. 2007;7:6570.
96
Wilk JN, Bilsborough J, Viney JL. The mdr1a-/- mouse model of spontaneous colitis: a relevant and appropriate
animal model to study inflammatory bowel disease. Immunol. Res. 2005;31:1519.
97
Schön MP. Animal models of psoriasis: a critical appraisal. Exp. Dermatol. 2008;17:703912.
98
Cohen PL, Maldonado MA. Animal models for SLE. Curr. Protoc. Immunol. 2003;Chapter 15:Unit 15.20.
99
Takeda K, Gelfand EW. Mouse models of allergic diseases. Curr. Opin. Immunol. 2009;21:6605.
100
Woyach J, Furman RR, Liu TM, et al. Resistance mechanisms for Bruton’s tyrosine kinase inhibitor ibrutinib.
New Engl. J. Med. 2014;370:228694.
101
Poidevin M, et al. Small-molecule screening using Drosophila models of human neurological disorders. Methods
Mol. Biol. 2015;1263:12738.

CLINICAL TRIALS
14 1. ORIGINS OF DRUGS

Moreover, Pandey and Nichols (102) state the investigators was to suppress neurodegen-
that the fruitfly is useful for determining the eration in human patients. The Patent Office
mechanisms and for drug screening for a vari- refused to accept the fruitfly model as a
ety of human disorders. According to these suitable model for treating Huntington’s dis-
authors, the fruitfly: ease in humans. The reasons for refusing to
accept the fruitfly model include the following:
can effectively be used for . . . high-throughput
drug screens as well as in target discovery . . . [and • Invertebrates models are unpredictable.
for] models of human diseases and opportunities • Drugs cannot be administered to flies.
for therapeutic discovery for central nervous system Please note that invertebrates have an open
disorders, inflammatory disorders, cardiovascular circulatory system, and do not have any
disease, cancer, and diabetes.
arteries or veins (104).
• The method that successfully prevented the
Guidance on why certain animal models are disease in the fruitflies (mutating the smt
not appropriate for establishing efficacy of any gene in the chromosome) cannot be
given drug comes from an agency of the US performed on human patients.
government other than FDA, namely, the US • Mammalian animal models are closer to
Patent and Trademark Office (USPTO). From humans than invertebrates. The Patent Office
the USPTO, superlative and consistent guid- stated that, “non-human mammals . . . more
ance on certain issues is provided by the closely replicate the essential features of
Patent Trial and Appeal Board (PTAB). This the pathophysiology of the disease in
guidance takes the form of many thousands of humans, as compared to invertebrate
published opinions from the Board, for exam- models” (105).
ple, Ex parte Steffan (103).
Ex parte Steffan concerned a proposal to treat In a similar published opinion from the
a human disease (Huntington’s disease) with a Board, the Board considered the ability of a
drug, where this proposal was based on data genetically modified mouse to be a model for
from an animal model. The animal model was treatment of human degenerative diseases. As
a genetically altered fruitfly. In the fruitfly described in Ex parte Franzoso (106) the geneti-
study, the investigators discovered that the cally modified mouse was engineered to have
neurological disease in the fruitfly could be a mutation in the Gadd45beta gene. The even-
cured by mutating one of the fruitfly’s genes. tual goal of the investigators was to develop an
The gene was the smt3 gene. The mutation in administrable drug that inhibits the Gadd45beta
the smt3 gene suppressed neurodegeneration gene in humans. However, the Board refused
in the fruitfly, just as the eventual goal of to accept the mouse model.

102
Pandey UB, Nichols CD. Human disease models in Drosophila melanogaster and the role of the fly in therapeutic
drug discovery. Pharmacol. Rev. 2011;63:41136.
103
Ex parte Steffan, No. 2009-005999 (B.P.A.I. Mar. 2, 2010).
104
Brody T, Mathews TD. The release of zinc from leukocytes provoked by A23187 and EDTA is associated with
the release of enzymes. Comp. Biochem. Physiol. Part A 1989;94:6937.
105
Examiner’s Answer of Aug. 5, 2008, at 7, in file history of U.S. Patent Application No. 10/789,518.
106
Ex parte Franzoso, No. 20072724 (B.P.A.I. Mar. 12, 2008).

CLINICAL TRIALS
IV. ANIMAL MODELS 15
To summarize, fruitflies and other animals Regarding the history of the development of
such as zebrafish (107) (model for cardiovascu- animal models, one of the first steps in adopting
lar diseases), as well as treatment of mice by the rat as a standard animal took place at the
mutating a particular gene, are commonly used University of Wisconsin-Madison, where E.V.
as animal models for human diseases. However, McCollum advocated using rats instead of cows.
it is not likely that animals such as these will be Initially, the idea was met with adversity, as
accepted by the FDA to establish safety and effi- documented by McCollum’s statement that,
cacy for a given drug in humans, to the extent “Professor Hart was astonished and offended at
that the FDA will be persuaded to approve the my pronouncement on the cow project. He was
initiation of a clinical trial. The present commen- contemptuous of my suggestion that we turn to
tary helps to provide a definition of an the rat as an experimental animal” (109). Over
acceptable animal model for treating a disease, the course of decades, rats as well as other ani-
by an example of what is not an acceptable model. mals, became standard models for testing vari-
ous pharmaceuticals, as demonstrated by a
guidance document issued by the FDA (110).
d. Developing an Accepted Animal
A conventional animal model for arthritis
Model for a Disease involves the generation of arthritis-like symp-
The first step in arriving at an animal model toms by injecting antibodies raised against
for a disease is to develop an animal model that type II collagen into the animal (111,112). A
resembles the human condition, in view of the conventional animal model for multiple sclero-
physiology of the disease, symptoms of the dis- sis, called EAE, involves injecting myelin-
ease, and response to therapeutic interventions, derived proteins into the animal (113,114).
such as to an administered drug. Varga et al. Recombinant animals that are animal models
(108) used the term “valid animal model” to refer for diseases include the PDAPP transgenic
to an animal model that resembles the human mouse model for Alzheimer’s disease, which is
condition, but this use of the word “valid” is not engineered to express a mutant human amy-
the same as the defined process of “validation.” loid precursor protein (115). An animal model

107
Asnani A, Peterson RT. The zebrafish as a tool to identify novel therapies for human cardiovascular disease.
Dis. Model Mech. 2014;7:7637.
108
Varga OE, et al. Validating animal models for preclinical research: a scientific and ethical discussion. Alternat.
Lab Anim. 2010;38:2458.
109
McCollum EV. The paths to the discovery of vitamins A and D. J. Nutr. 1967;91(Suppl. 1):116.
110
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry.
Estimating the safe starting dose in clinical trials for therapeutics in adult healthy volunteers; 2002.
111
Nandakumar KS, et al. Collagen type II-specific monoclonal antibody-induced arthritis in mice: description of
the disease and the influence of age, sex, and genes. Am. J. Pathol. 2002;163:182737.
112
Stuart JM, et al. Collagen autoimmune arthritis. Annu. Rev. Immunol. 1984;2:199218.
113
Yednock TA, et al. Prevention of experimental autoimmune encephalomyelitis by antibodies against alpha 4
beta 1 integrin. Nature 1991;356:636.
114
MacKay IR, et al. Immunopathological comparisons between experimental autoimmune encephalomyelitis and
multiple sclerosis. Clin. Exp. Immunol. 1973;15:47182.
115
Schenk D, et al. Immunization with amyloid-beta attenuates Alzheimer-disease-like pathology, the PDAPP
mouse. Nature 1999;400:1737.

CLINICAL TRIALS
16 1. ORIGINS OF DRUGS

that was created with recombinant technology agency, such as a national or international
is the “Harvard Mouse,” which is a mouse organization.
engineered to express an oncogene, such as the
c-myc gene (116).
The European Medicines Agency (EMA) has f. GLP, as It Applies to Animal Studies
provided guidance for assessing the validity GLP is a set of standards set forth by the
of a given animal model for use in testing the FDA.
efficacy of a drug for a particular disease. Before the FDA grants approval to a Sponsor
According to the EMA (117): to initiate recruiting of human subjects and to
conduct a clinical trial, the Sponsor is required
Qualitative and quantitative differences may to submit nonclinical safety and toxicology
exist in biological responses in animals compared to
humans. For example, there might be differences in
studies to demonstrate that the proposed drug
affinity for molecular targets, tissue distribution of entity is likely to be safe with testing in a clinical
the molecular target, cellular consequences of target trial on human subjects. The term “nonclinical
binding, cellular regulatory mechanisms, metabolic studies” encompasses studies with animals,
pathways, or compensatory responses to an initial in vitro cell culture, and the Ames bacterial
physiological perturbation.
mutagenicity test. These nonclinical studies
are governed by GLP regulations (119). GLP is
e. Validation of Animal Models regulated by Title 21 CFR y58. Title 21 CFR y58
is entitled, “Good Laboratory Practice for
After an animal model has been identified or Nonclinical Laboratory Studies.” If there are
developed, one can establish the validity of that deficiencies in GLP, for example, in the mainte-
model by way of the process of “validation.” nance of the animal facility, the FDA may issue
According to Varga et al. (118), validating a Refuse to File (RTF) notice. The consequence of
an animal model includes development of a the RTF notice is that the FDA halts any further
particular procedure or test that uses a specific review of the Sponsor’s application, until the
type of animal, followed by employing the Sponsor takes appropriate remedial action. Title
laboratory procedure, independently conducted 21 CFR y58 provides concrete guidance on what
in a blind trial, by at least three different labora- is required for animal studies. For example, 21
tories. This interlaboratory trial is followed by CFR y58.90 sets forth requirements for animal
data analysis and an evaluation of the outcome care:
of the study in comparison with predefined
performance criteria. The final step in validation Animal cages, racks and accessory equipment
may take the form of acceptance by a regulatory shall be cleaned and sanitized at appropriate

116
Pattengale PK, et al. Animal models of human disease. Pathology and molecular biology of spontaneous
neoplasms occurring in transgenic mice carrying and expressing activated cellular oncogenes. Am. J. Pathol.
1989;135:3961.
117
European Medicines Agency. Committee for Medicinal Products for Human Use (July 2007) Guideline on
Strategies to Identify and Mitigate Risks for First-in-Human Clinical Trials with Investigational Medicine Products
(12 pp.).
118
Varga OE, et al. Validating animal models for preclinical research: a scientific and ethical discussion. Alternat.
Lab Anim. 2010;38:2458.
119
Adamo JE, Bauer G, Berro, M, et al. A roadmap for academic health centers to establish good laboratory
practice-compliant infrastructure. Acad. Med. 2012;87:27984.

CLINICAL TRIALS
IV. ANIMAL MODELS 17
intervals . . . [f]eed and water used for the animals noncompliance adversely affects the validity of
shall be analyzed periodically to ensure that the animal studies or any other nonclinical lab-
contaminants known to be capable of interfering
with the study and reasonably expected to be
oratory studies, or where the Sponsor ignores
present in such feed or water are not present at levels warnings from the FDA.
above those specified in the protocol. Documentation The term “483” is known throughout the
of such analyses shall be maintained as raw data. pharmaceutical industry (120). Following an
inspection of a testing facility by FDA officials,
To give another example about animal the FDA may issue a warning on a document
care, 21 CFR y58.120 sets forth requirements called, Form FDA-483. The nature of Form
about written protocols, records of test articles FDA-483 is as follows (121):
(drugs), animal weight, and diet:
The FDA-483 is the written notice of objection-
Each study shall have an approved written pro- able practices or deviations from the regulations
tocol that clearly indicates the objectives and all that is prepared by the FDA investigator at the end
methods for the conduct of the study. The protocol of the inspection. The items listed on the form serve
shall contain . . . [i]dentification of the test and con- as the basis for the exit discussion with laboratory
trol articles by name, chemical abstract number, or management at which time management can either
code number . . . [t]he number, body weight range, agree or disagree with the items and can offer possi-
sex, source of supply, species, strain, substrain, and ble corrective actions to be taken.
age of the test system . . . [a] description and/or
identification of the diet . . . [e]ach dosage level, Regarding validation of each written proto-
expressed in milligrams per kilogram of body
weight or other appropriate units, of the test or con-
col, it is the case that the FDA acknowledged
trol article to be administered and the method and the need for flexibility in how the Sponsor
frequency of administration. establishes validity. To this end, the FDA’s
Guidance for Industry states that (122):
Thus, it is self-evident that GLP encompasses
a number of topics relating to the Sponsor’s Who assesses protocol validity (Number of ani-
mals, test article dosage, test system, etc.)? This is
laboratories. These topics overlap those used done by the study scientists using the scientific liter-
in basic research, but with the following excep- ature, published guidelines, advice from regulatory
tion. In basic research, laboratory procedures agencies, and prior experimental work.
are likely to change every month, in response to
experimental results. However, GLP allows for If a Sponsor submits data from animal
little flexibility and hence is not compatible studies, as part of an FDA submission, the FDA
with most types of basic research. may respond by sending a RTF notice to the
If a sponsor is found not to comply with Sponsor. According to the FDA’s Manual of
GLP, then the FDA may respond by disqualify- Policies and Procedures, the FDA issues a RTF if,
ing a testing facility (21 CFR y58.202). Grounds “[t]he application does not contain a statement
for disqualification include a situation where for each nonclinical laboratory study that it was

120
Pritchett T. A 483 Primer. Learning from the mistakes of others. BioProcess Int.; March 2011 (4 pp.).
121
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry. Good
laboratory practices questions and answers; July 2007 (25 pp.).
122
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry. Good
laboratory practices questions and answers; July 2007 (25 pp.).

CLINICAL TRIALS
18 1. ORIGINS OF DRUGS

conducted in compliance with the requirements device that is called, “Warning Letters,” it is
set forth in 21 CFR Part 58” (123). The FDA has not the case that Form 483 is exactly the same
commented on the frequency of RTF decisions, thing as a Warning Letter. Form 483 letters are
where these decisions are based on a number of issued with a minimal amount of review while,
problems, not merely on issues in test animals in contrast, Warning Letters are issued by the
that occur in nonclinical studies (124). FDA only after high-level review by attorneys
GLP is applied, for example, to in vivo employed by the FDA (127). It is common for
mutagenicity studies, acute toxicity studies, Form 483 to be referred to as a “warning letter”
chronic toxicity studies, and carcinogenicity (128). For convenience, the present commentary
studies. However, GLP does not apply to clini- refers to Form 483 as a “warning letter.”
cal studies, or to studies on veterinary drugs The following Warning Letter complained
in animals (125). A quality assurance manager, about the Sponsor’s failure to clean animal cages.
quality control analysts, and standard operat- The Warning Letter refers to a SOP, and to the
ing procedures (SOPs), are used in laboratories failure of the Sponsor to comply with this par-
operating under GLP (126). ticular SOP (129):

Dear Dr. [REDACTED]:


g. Examples of FDA Form 483 Warning The FDA investigators met with you and other
Letters, as Applied to Animal Studies members of your staff to review [your] Corporation’s
conduct of nonclinical laboratory studies . . . per-
FDA Form 483 warning letters are available formed under the Good Laboratory Practice (GLP)
on the FDA’s website. Problems relating to ani- for Nonclinical Laboratory Studies regulations [21
mals are only one of the many problems that CFR Part 58] . . . [a]t the end of the inspection a Form
can provoke the FDA to issue a Form 483. FDA 483, Inspectional Observations, was issued and
discussed with you . . . we conclude that [your com-
Please note the following. Although Form 483 pany] has violated GLP regulations governing the
letters are available on the FDA’s website
123
U.S. Department of Health and Human Services. Food and Drug Administration. Manual of policies and
procedures. Good review practice: refuse to file; October 11, 2013 (21 pp.).
124
According to Janet Rehnquist, “[a]lthough FDA can refuse to file applications, it rarely does so. The CDER
refused to file 4 percent of submitted applications in FY 2000, down from 17 percent in 1993. In part, this decrease
may be attributable to the advice FDA provides sponsors that helps them prepare higher quality applications.”
See, Rehnquist, J. FDA’s review process for new drug applications. A management review. Department of Health
and Human Services; March 2003 (47 pp.).
125
Adamo JE, Bauer G, Berro M, et al. A roadmap for academic health centers to establish good laboratory
practice-compliant infrastructure. Acad. Med. 2012;87:27984.
126
Adamo JE, Bauer G, Berro M, et al. A roadmap for academic health centers to establish good laboratory
practice-compliant infrastructure. Acad. Med. 2012;87:27984.
127
According to Cooper and Fleder, “[a] #483 is issued by one or more FDA investigators at the conclusion of a site
inspection, and usually is not reviewed by a compliance officer, district director, or an official in FDA’s
headquarters before it is issued. An FDA warning letter, on the other hand, is issued by a district director or
headquarters official of similar seniority, and only after review by FDA’s Office of Chief Counsel.” See, Cooper
RM, Fleder JR. Responding to a Form 483 Warning Letter: a practical guide. Food Drug Law J. 2005;60:479.
128
Senger JM. Emerging issues in FDA regulation: warning Letters, internet promotion, and tobacco. J. Health Care
Policy 2010;13:21125.
129
Warning Letter, CBER-09-01, January 5, 2009.

CLINICAL TRIALS
IV. ANIMAL MODELS 19
proper conduct of nonclinical studies as published approval for treatments for plague due to
under 21 CFR Part 58 . . . [y]our firm did not check Yersinia pestis was granted using the African
every animal cage for feed and water each day, or
clean the animal cages for study (b)(4) for twelve
green monkey model, approval for a treatment
days . . . [a]s a result, the animals were not checked for cyanide poisoning was granted using a
(b)(4) as required in the Animal Care Schedule SOP. dog model, and approval for a treatment for
smallpox (variola virus) was granted using
To provide another example, the follow- monkeypox virus in primates and rabbitpox
ing Warning Letter complained about the in rabbits (131). To provide another example,
Sponsor’s failure to analyze a specimen from a the FDA has also described the hypothetical
test animal (130): treatment of a drug to treat gastrointestinal dis-
orders resulting from acute radiation exposure
Dear Mr. [REDACTED]: in the case of a nuclear detonation (132).
FDA investigator . . . met with . . . members This avenue for drug approval is called the
of your staff to review your firm’s conduct of Animal Rule. The Animal Rule finds a basis in
study [REDACTED] performed under the Good
Laboratory Practices (GLP) regulations [21 CFR
Sections 314.600 (small molecule drugs) and
Part 58] . . . [a]t the end of the inspection, a Form 601.90 (biologicals) of the Code of Federal
FDA 483 . . . was issued and discussed with . . . your Regulations. According to the FDA’s Guidance
staff . . . [t]hese specimens represent eight of the . . . for Industry (133):
animals in one of the . . . dose cohorts required
for . . . studies at the . . . week time point. The box
The Animal Rule states that for drugs developed to
packed on 12/8/05 was not found until almost one
ameliorate or prevent serious or life threatening condi-
year later during the FDA inspection. The final report
tions caused by exposure to lethal or permanently dis-
for study . . . was signed by the study director on 04/
abling toxic substances, when human challenge
06/06 with no indication that these samples were
studies would not be ethical to perform and field trials
missing, as evidenced by the lack of protocol deviation
to study effectiveness after accidental or intentional
report in the study file. Your letter acknowledges that
human exposure have not been feasible, FDA may
these samples were not analyzed. You explain that
grant marketing approval based on adequate and
these animals were administered an [REDACTED] test
well-controlled animal efficacy studies when the
article dose and were not included in the final study
results of those studies establish that the drug is rea-
report. We disagree with your claim that these sam-
sonably likely to produce clinical benefit in humans.
ples had no bearing or impact on the study data.

In addition to the requirement that use of


h. Animal Rule human subjects not be ethical, the FDA
Where a Sponsor seeks FDA approval of requires that the mechanism of action of the
a drug, but where use of human subjects disorder in the animal model correspond to
would be unethical, the FDA permits use of the mechanism of action of the disorder in
animal model data as the basis for approval for humans, and that the mechanism of action
administration in humans. For example, FDA of the proposed treatment in the animal model

130
Warning Letter, CBER-07-007, March 23, 2007.
131
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry.
Product development under the animal rule; May 2014 (53 pp.).
132
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry.
Product development under the animal rule; May 2014 (53 pp.).
133
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry.
Product development under the animal rule; May 2014 (53 pp.).

CLINICAL TRIALS
20 1. ORIGINS OF DRUGS

also correspond to the mechanism of action of i. FDA’s Decision-Making Process in


the treatment in humans. Regarding the need Evaluating Raxibacumab, for Treating
for mechanisms in the animal model to track Bacillus anthracis Infections
mechanisms in humans, the FDA refers to the
example of treatment of pneumonic plague At the time of drug approval, the FDA pub-
caused by Y. pestis. The FDA states that infec- lishes its Approval Letter along with its Medical
tion by this bacterium can occur by way of flea Review or Clinical Review, Pharmacological
bites, which causes bubonic plague, while Review, Statistical Review, and other reviews.
infection by inhalation of the bacterium causes The following is from the FDA’s approval
pneumonic plague. Thus, for obtaining regula- of raxibacumab, for treating B. anthracis infec-
tory approval for a drug against pneumonic tions. The drug is an antibody for treating
plague, the animal model must use an inhala- anthrax.
tion route (not a flea bite route) for the bacte- Thus, it can be readily understood that it is
rium (134). To provide one more example of rarely or never the case that any human sub-
the need for the mechanisms in the animal jects will be available for this type of clinical
model to track those in the human, the FDA trial. This example is from BLA 125349, which
states that, “[i]f the thresholds in humans is available from December 2012 of the FDA’s
and in the animal model differ greatly, the website. Please note that efficacy data were
suitability of the animal model may be called collected from studies on rabbits and monkeys,
into question and the model should be while safety data were collected from studies
discussed with FDA” (135). on human volunteers. The human volunteers
Use of the Animal Rule for gaining FDA where healthy, and were only treated with the
approval for drugs for human patients has study drug (and not exposed to any anthrax
been detailed for the indications of smallpox bacteria).
(136,137), pneumonic plague (138), ebola virus The FDA reviewer stated that the animal
(139), anthrax (140), and radiation (141). studies indicate that the study drug shows

134
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry.
Product development under the animal rule; May 2014 (53 pp.).
135
U.S. Department of Health and Human Services. Food and Drug Administration. Guidance for industry.
Product development under the animal rule; May 2014 (53 pp.).
136
Trost LC, et al. The efficacy and pharmacokinetics of brincidofovir for the treatment of lethal rabbitpox virus
infection: a model of smallpox disease. Antiviral Res. 2014;117:11521.
137
Olson VA, Smith SK, Foster S. In vitro efficacy of brincidofovir against variola virus. Antimicrob. Agents
Chemother. 2014;58:55701.
138
Graham VA, et al. Efficacy of primate humoral passive transfer in a murine model of pneumonic plague is
mouse strain-dependent. J. Immunol. Res. 2014;2014:807564.
139
Sullivan NJ, et al. Correlates of protective immunity for Ebola vaccines: implications for regulatory approval by
the animal rule. Nat. Rev. Microbiol. 2009;7:393400.
140
Williamson D. Approaches to modeling the human immune response in transition of candidates from research
to development. J. Immunol. Res. 2014;2014:395302 (6 pp.).
141
Gluzman-Poltoruk Z, et al. Randomized comparison of single dose of recombinant human IL-12 versus placebo
for restoration of hematopoiesis and improved survival in rhesus monkeys exposed to lethal radiation. J. Hematol.
Oncol. 2014;7:31 (12 pp.).

CLINICAL TRIALS
Another random document with
no related content on Scribd:
CHAPTER II.
That may gar one cry, but it canna gar me mind.
Heart of Mid Lothian.

“Well, Charlotte,” said Mr. Gilmer, after they had been married
about six weeks, “I suppose our wedding gaieties are nearly over?”
“Oh! I hope not,” cried she, looking almost aghast at the idea.
“Why they have scarcely more than begun. There would be very little
use in being a bride indeed, if it were to end so soon,” she continued.
“So soon!” replied her husband. “Why I should think that even
you would be tired of this incessant gaiety. I fairly long for one quiet
dinner and evening at home.”
“I agree with you,” she returned, “the dinners are bores. To be
obliged to sit four or five mortal hours and talk is very dull. But the
balls are delightful, and I hope may continue these three months.
You don’t dance, however,” she added, “and I don’t wonder you find
it tiresome. Mamma used to complain of it too, and I dare say it is
dull to you old folks who look on. But to us who waltz, you don’t know
how charming it is,” and as she shook back her curls and looked up
in his face, with such an expression of youthful delight, he was
compelled to swallow with good humor the being classed with
“Mamma” and the “old folks,” unpleasant as it might be, in the hope
that she would soon weary of this heartless gaiety, and ceasing to be
a child, “put away childish things.”
Finding, however, that her youth was more than a match for his
patience, he soon wearied of playing the indulgent lover, and within
two months after their marriage he said,
“Charlotte, after to-night we go to no more evening parties. I am
thoroughly tired of them, and you have had enough for this season.”
She would have remonstrated, but the decision, almost
amounting to sternness with which he spoke, startled her, and she
only pouted without replying. Her usual resource, to complain of her
husband to her mother, was left her, and Mrs. Vivian’s spirit quickly
fired at seeing her darling child thwarted, and she said with the
feeling more natural than judicious in a mother-in-law,
“Tell your husband, Charlotte, that if he does not wish to go, I am
always ready to accompany you,” and the young wife returned
triumphantly to her husband to say, “that mamma would take her to
Mrs. Johnson’s.” Mr. Gilmer could not reasonably object to the
arrangement, little as he liked it; but thus Mrs. Vivian laid the
foundation of a dislike between her son-in-law and self that took root
but to flourish and strengthen with time.
Mrs. Vivian calling soon after on her daughter, found her poring
over a large volume most intently.
“What are you reading, Charlotte?” inquired her mother.
“Oh!” she said, tossing the book from her, “the stupidest thing you
ever read. Mr. Gilmer insisted on my reading it. He wants me to
‘cultivate my mind,’ to read and think, but I won’t think for him,” she
said, pettishly pushing the book from her, “he can’t make me do that,
do what he will. Now is it not hard,” she said, appealing to her
mother, “that just as I have left school, I should be surrounded by
masters and forced to study? He insisted on engaging Signor F. to
give me Italian lessons, as he says that time will hang heavy on my
hands if I have nothing to do when he is absent. Not nearly as heavy,
I can tell him, as when I have something to do I don’t like. And, then,
these stupid dinners he will give, where he has only grave, sensible
old men. If I had thought I was to lead such a life as this, I would
have married a young man at once;” and thus she poured out her
complaints, which were “as fresh from a warm young heart,” as Mr.
Gilmer himself could have desired in his most enthusiastic mood. In
fact, he was beginning to find that this “cultivating a wife’s mind” was
not the easy delightful task he had once promised himself; and the
naïveté that had so charmed him before his marriage, annoyed him
now not a little, as he saw it amuse his friends, particularly Mr.
Lowndes, whose quick eye would involuntarily glance at him as his
wife let forth most unconsciously some of the little disagrémens of
their ménage. That same naïveté is the most unmanageable quality
in an establishment where all does not run smoothly, and for that
very reason, perhaps, often more amusing to strangers. But we pity
the proud reserved man who is to be tortured with the “simplicity” by
which he was once captivated.
And if she was weary of the “grave sensible men” that
surrounded his table, he was not less so of her young companions,
who chattered and gossiped till his ears fairly ached with their
nonsense.
The career of self indulgence, generally denominated a “gay life,”
that Mr. Gilmer had led, was not the best of preparations for an
indulgent husband, and resuming, as time wore on, the selfishness
that had been laid asleep or aside in the first excitement of winning
his little beauty, he became more decided and less tender in his
manner toward his young wife. Finding he could not make her a
companion, and having no respect for her understanding, nor
sympathy in her tastes, he soon began to treat her as a child, that is,
as a being having no rights. She on her side, quicker in feeling than
defining, felt as every child feels, when defrauded of their due, that
she had claims to assert as well as himself; and thus commenced a
struggle that each urged as far as they dared. We say dared, for
there was a cold, stern decision about him, that awed her in spite of
herself; and he saw a look in her eye sometimes that told him it were
best not to push matters to extremities, or he might raise a spirit,
once raised not so easily laid. Mrs. Vivian seeing her beautiful child
consigned to the cold selfishness rather of a step-father, than the
indulgent affection of a devoted husband as she had expected,
injudiciously took part in their little differences, and could not help
giving her son-in-law an occasional cut that neither sweetened his
temper nor mended his manners. He respected her understanding,
and feared her penetration; and fear and respect too often engender
dislike; and it was not long before a state of feeling arose between
mother and son-in-law less seldom than sorrowful.

——
CHAPTER III.
“Nae treasures nor pleasures
Could mak us happy long;
The heart’s aye the part aye
That makes us right or wrong.”
Burns.

The birth of a daughter at length opened new feelings and hopes


to the parents; and the thought “that Mr. Gilmer could no longer treat
her as a child, and require her to study and read,” added not a little
to the happiness that flashed in Charlotte’s eyes as she kissed her
baby with rapture; and the quiet but deep satisfaction with which Mr.
Gilmer contemplated his child, was partly founded in the expectation,
“that Charlotte, in assuming the duties and feelings of a mother,
would sink the giddiness of the girl in the steadiness of the woman.”
But little did he know in supposing that youth and nature were thus to
be cheated of their privileges by the assumption of the
responsibilities of maturer age. That Charlotte loved her infant with
the liveliest affection, is true; but it was rather the playful fondness of
a child for its play-thing than the passionate love of a mother for her
first born; and although she would delightedly fondle the infant for a
few minutes, yet easily terrified by the cries of the little creature,
drawn forth by the awkward handling of its inexperienced parent, she
would quickly resign it to the soothing cares of its nurse, who, in fact,
dreaded the sight of the young mother in the nursery. Once, indeed,
after having been admonished and lectured by her husband on her
new duties and responsibilities, she took it in her head, at the
imminent risk of life and limb of her child, to wash and dress it
herself, and which was most terrified and exhausted under the
operation, mother or child, it would be difficult to say; and very soon
she resumed her usual routine of life, only varied by occasional visits
to her nursery. Mr. Gilmer, disappointed in the change he had hoped
to see in her character and tastes, became more impatient and less
yielding than before. Had he, in the indulgent spirit that should have
accompanied his age and knowledge of the world, given way to the
joyous spirits and excitable feelings natural to her youth, he would
have won to himself a heart naturally warm and affectionate, at the
same time that he quenched her ardent love of pleasure in satiety.
But, too selfish to put that constraint on himself, he expected at once
that calm indifference to society, in a girl of scarce eighteen, that was
in himself the result of twenty-five years devotion to its frivolities, and
his wife’s thirst for gaiety seemed to increase in proportion to the
difficulties and objections he threw in the path of her enjoyment—
and it was but natural that she should escape with delight, looks of
grave displeasure, quick words of impatience, and selfish
forgetfulness of her tastes at home, for the gaiety of brilliant throngs
where she was followed, admired and flattered, and which she
enjoyed the more, that the opportunities were rare and doubtful.
And thus time wore on, adding rather than diminishing the
discontents of all parties. We have said before that the feelings
subsisting between Mrs. Vivian and her son-in-law were any thing
but kind and friendly; and they now rarely met without quick and
biting sarcasms on her side, retorted by a cold and haughty
disrespect on his. Age, too, was now adding its usual exactions to
his natural selfishness of character, and that he might enjoy that
luxurious indolence and tranquillity so necessary to his happiness,
and withdraw his wife from the pleasure so opposite to his tastes,
and, above all, that he might free himself from the interference and
investigation of Mrs. Vivian, and separate Charlotte from her mother
as much as possible, he resolved to purchase a place in the country.
Regardless of the wishes of his wife, heedless of her remonstrance,
the idea was no sooner conceived than executed, and however
much Mrs. Gilmer disliked the removal, there was no resource but to
submit. That she submitted with a good grace we cannot say, for
Charlotte had now learned to think, (as what woman does not that
makes an ill-assorted marriage?) although her mind had not
expanded in the direction that her husband desired. She had
become acquainted with her own claims, and in penetrating the
heartlessness and hollowness of her husband’s character, had
learned to mourn over the sacrifice of her youth and beauty with
indignation and anguish. Resenting the steady pursuance of his own
plans, to the utter exclusion of all consideration for her wishes, she in
her turn became careless of his comforts and negligent of her duties.
Who that passed that beautiful place, with its rich lawns, noble trees
and magnificent views, would have suspected the discontented
tempers and unsatisfied hearts that dwelt in that embowered
paradise. Her child was a source of unmingled happiness to her as it
grew in beauty and intelligence. But will the love of a child alone
compensate for that want of companionship and sympathy that the
heart asks for in vain where there is no equality of mind or years?
The society of her mother had been her greatest source of
comfort during the last few years of her existence, as she turned to
her for that indulgence and love of which she felt the want more and
more; and which was poured forth upon her more fully in her hour of
disappointment than even in her petted childhood by her doting
parent. And now how gladly did she hail every little excuse the calls
of life afforded her, the procuring a servant, the necessary
purchases, &c., to drive to the city and spend as many hours as
possible with that dear friend. And oh, how doubly happy was she on
such occasions, if she were caught in a storm, or losing the boat,
was compelled to remain a few days in that small house, which with
its mean furniture she had once been so anxious to escape, but
which was now to her the centre of all happiness, for there she found
liberty, sympathy, love; and her mother acknowledged to herself that
when she had so anxiously essayed to guard her child from every
sorrow and trial of life, she had attempted a task not to be achieved
upon earth. Cares and sorrows are the lot of earth’s children; but
they fall comparatively lightly on those whose hearts are
strengthened and sustained by an all-supporting and enduring love
for those to whom fortune has connected their destiny.
And was Mr. Gilmer happier for the new mode of life he had
adopted? No. Accustomed to the habits of a city, he was wanting in
that personal activity necessary for the enjoyment of country
pleasures, or keen interest in the agricultural improvement of his
place. His literary pursuits, wanting the stimulus of congenial spirits,
was degenerating into careless reading and sedentary habits, only
diversified by light dozing; and, after spending the afternoon and
evening hours in his library alone, there was a dreamy abstraction in
his eye, that the keen vigilance of Mrs. Vivian having once detected,
she knew immediately came neither from literary excitement nor
intellectual meditation. Thus will the selfish pursuance of one’s own
gratification, alone, fall back upon the head of him who essays to
secure all for himself in yielding nothing to others.
A wasted youth and useless manhood must end in a neglected
and unhonored age.
Should a few years bring forth a young and beauteous widow,
society may look for the natural results of an unnatural youth, in that
saddest of anomalies, a gay widow. And should she essay a second
“Experiment of Living,” we fear that having been worldly when she
should have been romantic, she will now be romantic when it would
be more graceful, or at least more respectable, to be worldly, and the
result will scarcely be less unfortunate and infinitely more ridiculous
than the first.
F. E. F.
Fanny Corbaux H. S. Sadd, N. Y.

The Pet Rabbit

Engraved expressly for Graham’s Magazine.


THE PET RABBIT.
True were your words, heart-reader, Jacques Rousseau⁠—
’Tis woman’s nature to be loving ever;
Though like the winds, the amorous winds that blow,
She to one object may be constant never.

The gentle Julia, fickle as she’s fair,


Still cannot triumph o’er the pleasing habit.
Live without love? As well without the air!
She scorns her husband, but—adores her rabbit.
Painted by Destouches. Engd by J.N. Gimbrede.

The Reprimand

Engraved expressly for Graham’s Magazine.


THE REPRIMAND.
———
BY EPES SARGENT.
———

In this utilitarian, leveling, democratic age, when candidates for


the Presidency are expected to attend “mass clam-bakes,” at
Seekonk, Squam, or some equally central and populous locality, it is
quite delightful to meet with a good, old-fashioned, uncompromising
aristocrat like Aunt Adeline. Possessing no discoverable attraction,
personal, intellectual, or moral—masculine in her features, voice and
manners—penurious in her habits—and violent in her prejudices—all
these little foibles and defects are redeemed and dignified by her
magnificent family pride. Her grandmother was niece to a lady,
whose husband had a cousin, whose husband’s brother’s wife’s
sister had been lady-in-waiting to Queen Anne. What a blessed
privilege! What a cause for felicitation and delicious retrospection to
the remotest posterity!
Amy Ammidon and her brother Harry had the never-to-be-
sufficiently-appreciated good fortune to be the children of Aunt
Adeline’s brother, and to partake consequently in the lustre of her
ancestral glories. At the time of the incident, the particulars of which
have been communicated to me, Mr. Ammidon, who had been a
prosperous merchant, had met with reverses in business, which
compelled him to circumscribe his expenditures. Harry was
supposed to be traveling in Europe; and Aunt Adeline, much to the
chagrin of all concerned, had undertaken to supply the void in the
family, occasioned about a year before by the death of an
affectionate mother and wife, by taking up her residence amongst
them. Such were the circumstances of the little group early in the
spring of 1842.
What a dear, artless, sunny-tempered creature was Amy! Vainly,
vainly has the limner tried accurately to trace her face and figure. He
deserves credit for what he has done. I can see a resemblance—a
strong one, in the picture which the graver of Gimbrede has
transferred to steel. But where is the ever-varying expression, the
sparkling animation of lip and eye, too evanescent and too mutable
to be daguerreotyped even by memory with fidelity? Art can do
much, but it cannot do justice to such a Protean beauty as Amy.
Although born in the city—although the din of Broadway was the
first noise that broke upon her infant slumbers—Amy was as much
out of place in New York, with its reeking gutters, its eternal
omnibuses and its “indignation processions,” as a pond lily would be
in a tanner’s pit. The country, with its wealth of foliage, its fields and
its wild flowers, was her delight. The anticipation of visiting it seemed
to be alone sufficient to fill her heart with cheerfulness during the
winter months. A little cottage, in Westchester county, to which the
name of Glenwood had been given, and which had not been
sacrificed in the general wreck of her father’s property, was her beau
ideal of Paradise. And a delicious spot it was—cool, sequestered,
rich in its smooth lawns and ancient forests, and commanding a fine
view of Long Island Sound, from which a fresh breeze was wafted in
the hottest days of summer. I cannot imagine a more suitable place
at which to introduce Amy to the friendly regards of my readers.
But before I proceed, let me express my regret that a rigid
adherence to truth and candor will not permit me to conceal the fact
that there was one trait of character in which Amy was lamentably
and unaccountably deficient. Notwithstanding the lessons and the
example of her respectable aunt—notwithstanding the hereditary
blood in her veins—notwithstanding the family tree and the family
pictures, Amy had not one particle of that praiseworthy and truly
disinterested pride which springs from the contemplation of the
superiority of some remote ancestor over ourselves. She had not
sense enough to see (poor thing!) why the circumstance of her great
grandfather’s having been a bishop was a sufficient proof of her own
orthodoxy and worth, or what her grandmother’s merit had to do with
hers. Had she been in the habit of quoting poetry, she might have
adopted the base-spirited sentiment expressed by Pope:
What can ennoble fools, or knaves, or cowards?

A great fallacy, and one which never failed to excite the vehement
and proper indignation of Aunt Adeline! I am sorry that at the very
outset I am compelled to tell these things of Amy, but, as they
illustrate her conduct on an important occasion, they could not well
be omitted.
It was a bright and beautiful afternoon in June. The air from the
water was fresh and elastic. The bees about Glenwood were plying a
brisk business among the clover, and the birds were singing as if
their life depended on the amount of noise they could make. Amy
stole in from the piazza that encircled the cottage, and, with her
apron full of newly plucked flowers, sat down in the big leathern
armchair in the library to arrange a nosegay. To one who could not
sympathize with her admiration of their fragrance and beauty, her
delight would have seemed almost childish, for she kissed them and
laughed, and laughed and kissed them again, then put her forefinger
to her mischievous lips, and whispered “hush!” as if warning herself
against intrusion, then shrugged her ivory shoulders and laughed
once more, as if congratulating herself upon the undisturbed
enjoyment of some interdicted pleasure.
But Amy was mistaken in supposing that she was alone and
unobserved, for at that moment Aunt Adeline, who had been
watching her antics from behind a door, burst in upon her with an
exclamation which made her start from her seat and drop the half-
formed nosegay, and scatter the flowers upon the floor, while she
stood trembling like a culprit, with one hand grasping her apron, and
her left elbow instinctively resting on a couple of large volumes which
concealed a whole wilderness of pressed flowers.
And what was Amy’s crime? Listen, and perhaps you may find
out.
“So, Miss—so!” screamed Aunt Adeline, at the top of her voice,
which, in its melody, resembled a Scotch bag-pipe more than a
Dorian flute. And having uttered these monosyllables, she tossed
herself into the vacated chair, as if preparing for a reprimand of some
length. Then, pointing to the abandoned flowers, she sternly asked
—“How came you by those flowers? Speak, minx!”
Amy continued silent; and Aunt Adeline renewed her
interrogation with more severity. A little indignation began now to
mingle with Amy’s grief, and she was on the point of astonishing her
aunt with a spirited reply, when the latter exclaimed:
“You needn’t tell me where you got them, Miss. I know all about it.
They were given to you by that plebeian clodhopper, Tom Greenleaf,
the milk-man’s son. Yes, you mean-spirited thing, you. The milk-
man’s son!”
It was even so. Mortifying to my feelings as it is to make any such
admission in regard to a heroine of mine, I must confess that Aunt
Adeline was right, and that the flowers were the gift (pah!) of an
individual of thoroughly rustic extraction. Some twenty years since,
old Greenleaf was the owner of a snug farm on the island of
Manhattan; where he obtained a frugal subsistence by selling milk to
the denizens of the city. It was even true, that occasionally, when the
old man was confined at home by the rheumatism, Tom, who was
then a mere lad, would mount the cart and go the rounds in his
father’s stead. While engaged in this employment, it was his lot to
meet Amy Ammidon, whose family he supplied with the snowy
beverage enclosed in his large tin tubs. Amy was then as rosy-
cheeked, black-eyed a little maiden as ever perpetrated unconscious
damage in the hearts of venturous youths. Tom instinctively
discovered her fondness for flowers, and the nosegays he used to
bring her in consequence surpassed all computation. Years rolled
on; and one fine summer day the old milk-man was overwhelmed
with astonishment at discovering that his little thirty-acre farm was
worth a hundred thousand dollars. He sold out, purchased a
beautiful estate in Westchester, removed to it, and just as he was
beginning to feel the ennui of inert prosperity, he died, leaving Tom
the sole heir of his safely invested property.
Tom showed himself a man, every inch of him, in the course he
pursued. He had always had a taste for reading, and he now
devoted himself with assiduity to the attainment of a fitting education.
At the age of twenty-one he graduated at a respectable college, and
then wisely chose the profession of a farmer. He had not been home
many days, when in one of his walks he encountered his old friend
Amy. Both were equally delighted at renewing the acquaintance; and
one step led to another, until Tom had the audacity to send her the
nosegay which had called down Aunt Adeline’s appropriate
indignation.
“Hear me, Amy Ammidon,” continued she; “if you dare to
disgrace your family by receiving the addresses of that son of a
cauliflower—that low-born, low-bred cultivator of turnip-tops and
radishes—that superintendent of hay-mows and pig-pens—that
vulgar cow-boy—if you dare to sully the blood of an Ammidon by
such a union, I will utterly disown you, and you shall never have the
advantage of my society again.”
Strange to say, Amy’s eyes brightened at this menace, and I am
afraid she was just on the point of exclaiming, “O, then, I will marry
him, by all means;” but she checked herself, and said: “Can’t one
receive a few flowers from a gentleman without risking the
imputation of being engaged to him?”
“Gentleman, indeed! Tom Greenleaf a gentleman!”
“Yes, Miss Adeline Ammidon,” exclaimed Amy in a tone which
transfixed her aunt with amazement, “as true a gentleman as any
ancestor of yours or mine ever was! A gentleman not only in mind
and manners, but what is better far, in heart—and therefore a perfect
gentleman!”
“Oh dear! What a deal of spirit Miss Innocence can show when a
word is said against the clodhopper! Why doesn’t she show as much
indignation when Frank Phaeton and Harry Hawker, from both of
whom she has had offers, are abused?”
“I shall be eighteen next January—heigho!”
“So, you mean by that to taunt me with your approaching
freedom; but we will have you married before that time in a manner
becoming your rank. Have you forgotten what I told you about Col.
Mornington, a son of the Earl of Bellingham, being in the city from
Canada? My friend, Mrs. Ogleby, has promised to give him a letter to
me, and I am daily expecting a call. When he comes, I mean to invite
him to pass a week at Glenwood, and if you are not a fool you can
bring him to your feet.”
“Isn’t he very dissipated?”
“That is not of the slightest consequence, my dear, when you
think of his splendid connections.”
“I am told he is utterly destitute of principle.”
“He will be a lord when his eldest brother dies. It is ridiculous to
bring up such frivolous objections.”
While this conversation was going on, Greenleaf, who had been
lying in wait for Amy near the porch, was attracted to the window by
the loud, objurgatory tones of aunt Adeline’s voice, and, to his
dismay, found that Amy was the victim of her anger. He was on the
point of jumping into the room, and gagging the old woman, when his
eye fell on a suspicious-looking flask near the window-sill, and he
charitably concluded that the cordial it contained was at the bottom
of the disturbance. How far this conjecture was correct I have never
been able to ascertain. Tom was soon joined by Amy, who, with tears
in her eyes, told him of her aunt’s violent behavior. The lovers
sauntered away, arm in arm, and, as they reached the termination of
a shady lane that opened upon the highway, they saw a carriage,
containing a young man of foreign appearance, with long hair and
moustaches, drive toward the cottage.
“That must be the Colonel Mornington, of whom Aunt Adeline
spoke,” said Amy, stifling a sob.
“Shall I knock him down?” asked Tom, clenching his fists.
Before Amy could reply, the carriage was suddenly stopped, and
the stranger, throwing open the door, jumped from it without waiting
for the steps to be let down. Then, rushing toward Amy, he threw his
arms about her neck, hugged and kissed her. So abrupt and rapid
was the act, that Greenleaf was thoroughly confounded at the
fellow’s impudence, and had no opportunity of interposing. He was
making preparations to seize the coxcomb, however, and throw him
over the hedge, when he was relieved by Amy’s exclaiming, “Brother
Harry! Is it possible? I should never have dreamed it was you, with
those frightful whiskers.”
“Yes, Amy, it is Harry himself. And you—how you have grown!
When I last saw you, you were a chubby little girl, But, Amy, Amy, is
that a tear on your cheek? What is the meaning of it?”
“Oh, nothing serious, I assure you. I am so glad—so very glad to
see you, Harry! You intend to remain with us, do you not?”
“Nay, I must know the meaning of that tear. Father is well, is he
not?”
“When I last heard from him, at Charleston, he was never better.
We are all well—quite well.”
“Introduce me to your companion, Amy.”
Amy did as her brother requested; and the introduction was soon
succeeded by a frank explanation of the position of the parties, and
of Aunt Adeline’s ferocious opposition to the existence of their
present relation.
“I will punish the old shrew,” exclaimed Harry. “I owe her an
ancient grudge, for making me go in petticoats, when a boy, a year
longer than was necessary. Let me see—she is daily expecting this
Colonel Mornington, you say?”
“Yes; and she is studying, with more zest than ever, the family
records, to enlighten him fully in regard to her pedigree.”
“Well, you must concur in a little plot, by which you can be
relieved from her present system of annoyance, and I can gratify the
long-deferred vengeance implanted by her opposition to my
appearance in jacket and trowsers. It is nearly ten years since she
saw me. Of course she will not recognize me with these hirsute
appendages. I will appear as Col. Mornington. I will make love to
you. You must prove fickle, and receive my attentions—and then
leave the dénouement to me.”
“Delightful! Do you approve of it, Thomas?”
“By all means. It will be a very harmless mode of revenging
ourselves.”
An hour afterwards, as Aunt Adeline was peeping through the
parlor blinds, she saw, as she supposed, the long expected carriage
of Col. Mornington dash up before the door, and the colonel himself
—the “dear, delightful colonel,” with a remarkably languid air, alight.
Preceded by a servant, she hastened to receive him, and, as the
door was thrown open, welcomed him to Glenwood with an
antiquarian courtesy. The colonel’s manner of receiving her
salutation was rather peculiar. Before replying to her greeting, or
saying a word, he slowly drew from his pocket a leather case, from
which he took an enormous opera glass. Then hunting, first in one
pocket and then in another, for a handkerchief, he finally succeeded
in finding one; and, in a manner which was not at all significant of
haste, proceeded to wipe the glasses. Then leisurely returning the
handkerchief to its place of deposit, he balanced himself in a sort of
easy straddle, coolly put the opera-glass to his eyes, and took a long
survey of Aunt Adeline’s physiognomy. As soon as he had finished
his inspection he returned the glass to its case, and asked, in a
drawling tone—“Are you Miss Am-Am-Amworth, or Amburgh, or
Am⁠—”
“Miss Ammidon, you probably mean,” said Aunt Adeline. “I am
that person, and you, sir, I presume, are Colonel Mornington. You
needn’t hunt for your letter of introduction. I have been expecting the
honor of a visit, sir, for some days, and now bid you heartily welcome
to Glenwood. Have the goodness to walk into the parlor. Your
baggage shall be taken care of. I must insist on your making our
cottage your home while you are in the village.”
“Thawideawquoitewavishesme,” said the colonel, but whether he
was speaking in the Choctaw or Hindostanee tongue, Aunt Adeline
could not guess.
Entering the parlor he encountered Amy, to whom he was at once
introduced by Aunt Adeline. He again went through the process of
inspection with the aid of an opera-glass, and Amy, in spite of her
aunt’s frowns, burst into a fit of laughter and left the room.
“Extwardinarygwirl!” exclaimed the colonel, in the same unknown
tongue. Then turning to Aunt Adeline, he abruptly asked for “bwandy
and water.”
As soon as she could comprehend his wants, she recollected,
much to her chagrin, that there was no brandy in the house; and
informed the colonel of the fact, promising at the same time to send
to the nearest grocery, which was a mile off, and obtain the desired
article.
“No bwandy! No bwandy in the house!” exclaimed the noble
visiter, staring at his dismayed hostess with an expression of utter
consternation and despair depicted in his countenance.
Assuring him that the brandy should be procured with all possible
expedition, Aunt Adeline hurried out of the room, and despatched all
the servants in different directions, promising a reward to that one
who would be the first to bring home a pint of brandy. No sooner had
she disappeared than Amy re-entered the parlor; and when Aunt
Adeline returned, which she did not venture to do until, after great
exertions, the brandy had been obtained, she saw to her surprise her
niece and the colonel sitting familiarly on the sofa, engaged,
apparently, in affectionate dalliance.
“Now, colonel, if you will try some of this brandy,” said Aunt
Adeline.
“Throw it away!” exclaimed the colonel, “here is something better
than eau de vie!” and saying thus, he kissed Amy, first on either
cheek, then on her lips, to all which she submitted with perfect
resignation. Aunt Adeline flung up both arms in astonishment. “This
is the quickest wooing,” thought she, “that I ever heard of!”
The colonel had not been two days in the family before it was
regarded as settled that he and Amy were affianced. Aunt Adeline
eagerly gave her consent, notwithstanding some little eccentricities
in the young man’s conduct, of which she did not wholly approve.
For instance, when she undertook to bore him with an explanation of
her family tree, he laughed in her face, and told her that his mare
Betsey could boast a better pedigree. This was touching the old
woman on a tender point, but she suppressed the exhibition of her
chagrin through a secret admiration of that superiority in blood,
which could afford to sneer at her genealogy. Another circumstance
was rather annoying, and some illiberal people might have
considered the trait it displayed objectionable in a lover. The colonel,
who had apparently been indulging too freely in strong potations, on
meeting Aunt Adeline alone on the stairs, was rude to the ancient
vestal, and even attempted to throw his arms about her neck. To tell
the truth, Aunt Adeline was a very little shocked at this ebullition, but
when she recollected that the aggressor was the son of an earl, she
forgave him with all her heart, and determined not to mention the
occurrence to her niece.
These, however, were but trivial symptoms of depravity,
compared with those which were soon developed. The colonel had
not been engaged two days when he petrified the “old woman,” as
he called her to her face, by applying to her for money. She could
have endured any thing but this without faltering in her alliance. He
might have been as tipsy and profligate as he pleased, and still she
would have thought him an excellent match for Amy; but in money
matters, Aunt Adeline was rigid and inexorable as death itself.
Although in the receipt of a competent annuity, she had always
contrived, from parsimonious motives, to live upon her friends and
relatives; and it was rare indeed that a dollar found its way from her
store. And now Colonel Mornington called upon her, peremptorily, for
a hundred dollars, and would not listen to a refusal! It was like
draining her of her life-blood, but there was no remedy. With a heavy
heart, and with many a longing, lingering look at the money, she
placed it in his hands. She had hoped that he would of his own
accord offer to give her his acceptance for the sum; but the idea
evidently did not occur to him, and she timidly hinted something
about a receipt.
“A what!” exclaimed the colonel in a tone, and with a stare, which
effectually prevented her from renewing the suggestion.
The very next day the colonel applied for another hundred
dollars, ingenuously informing her that he had experienced heavy
losses at the village nine-pin alley. Aunt Adeline at first peremptorily
refused to give him the amount, but she was finally so worked upon
by his taunts and menaces that she acceded to his exorbitant
demands. The same scene was repeated the next day, and the next,
and the next, until the colonel was her debtor to the amount of five
hundred dollars, when she unequivocally declared that she would
advance him no more money. The colonel left her presence,
muttering mysterious threats.

You might also like