Thanks to visit codestin.com
Credit goes to www.scribd.com

0% found this document useful (0 votes)
1K views152 pages

Advanced Language Practice Vince

english
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF or read online on Scribd
0% found this document useful (0 votes)
1K views152 pages

Advanced Language Practice Vince

english
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF or read online on Scribd
You are on page 1/ 152
Advanced Language Practice MICHAEL VINCE CENTROL ATI ating amc pa Contents a a . 1 agpantin? Se fateh ot eningemdponin 6 ti i ian inn Adee Langone Pai ning beri wa acest seeto Vanna eee ace cee ghee eld ier ge eet hr {ade gin veh loony och in vehi ile 8 veil aris 12 She ebay iba 0 tune 20 PROGRESS TEST 14 21 Wes falonesty positions 188 Yew tho oni Unt 2 etn nee, Tl ogg See ee scueres area ging oaks on Pere lg ont ost 25 Presets 19 Words and Phrases. Seema | Exresion vitheonamsban enh Ue 26 Pesan 2 16 slender, Geese opis sone. Us 25 reine 14 2 Byrne revi wher, Rposert oe ivi all farapeins at an 26 modes St 1, 2 Bin i ei ot 27 Tentesees 2! Secermeaing erm ney ae : « Fimlin compuid ins iin So Sepnetaae pee | Sag hein lang ly movement gecromlia theres 1D Methane bdy 30 Wadd 6 ym cw vn tee ar aa Cm "Bens een ton, lingered giets 7 Brenner pence” 1 Colecio ousted whe xrions ‘atfenopenan hang cg. pee 9 Ade ine peyons open whe, phenome dinar sane 10 Engin wtp groin nn ‘sbnrmimanpenionalns et soley Index 20 ‘Answer key 25 Use 29 Tenens 2 wit 30 nocress Test 1 nga et mening tg 31 foam fhe bo onicrvapsctmlingscaccnt ees 3 Rr Saline at Uneaterces and sunnneties 8 ct atnesentoe ad armen ide Tendon ua kann, Unt Mosel aus 1 resents 59 ip hea et Neyinimagie han myer ey fineness Ue 2 Mol ase 2 past 4s sehnemdmgthe woe Matheer dean eve 86 od — Necdtheorsdddetondie Ut erin 7 Inveronerege cbs 7 Seana ait ning Ine onda roo 72 “stag Bled cinema Changed re tchg ea 7 Mgrs rT dane oe Process EST (6 rect spenen snare 2 Tht lee penn ‘denna renee Changeefviwpocsho nad hat nom Lane adenine “yarn se 8 Rete /rantite sees 161 eign edi 01 ispecies Introduction “Thesn00K designed eis cone rma pits bee the CAE td Pefiircy nmin, Asay sare ened ‘hese ofvcablry the matcher ara aye Ieokindes pice wih nny ingens ener sel ‘ope vociuary and wae arene fe. “Therma stones bath reviion and mae ned ‘ts The ates sow npg ed poncaten Union pa ‘es repost and neue esa ned, The pommel ‘alrmatn provided enbeune fr reece when eteor sere ‘rough en ‘Te vacblayseconincdesforw ontopievrlay on clloeons soit pres Thi setnascyces vaca peptone, ‘Perl anpaer ‘Thntook canbe a sel-stdy relent amma pac bsk or snpplemenary mance repair BeCAE oe Probe craminatin fed or caster wean be done India orco-operiveyinpacrsmal pope ‘Thea replarpropes es whch ice fomsolesingeommoniy \sebinbthCAE and rofcieny. Teuton ang cy ‘ppreptinetobetheriiotin, aiconr Elpeent Steven ‘emiaesonor Simic Unit 1 Tense consolidation: present time Explanations 1 Proersingl pene es: Gr biba oder Clin pple dite en ieee ime 2 exam i ooh rye hemo Thar cn inter Sms bff Tayanbestly apres “aed icpig srr bed! nthe canbe enya buoy hppesingthe mone Talaenagi are 1 Stevi dre s coining ted ot etl bane sconinuous form Typ empl we Tele bln on conta, obi ee, ike oe mat nea oom prefer anda em oppo nes wea 2 Someveis haves suvemessing id diferent aie mening ‘ypu comple "a depend el bv mer, ink ih Sue Ere Jessi lieing ni. DendbarePonche “ere beingesineresing cove: ii ke yout stinking aout sep Thifubuatnfal! —Tempasttnig toe Heltbuyor erg, Tamfecing tote Thabegecgieton! | Weare weighing the bby digo hetyonmean, a deending nyo tert erro receipe “Teper or repented aot ‘Tintecenphuterstenponryorrepened ati acon ‘iy carbar broke doon Taming wer oe dy Areyouejyngywr aye? Campin bata er complaining aout mycoking! oe esa onan cnnel ower ma ovterpa Whyte debingchngeand delopnt at “Thing pecig wot * “ Morendnorrerb erie Maliogdecrinan' <2 aera a mndtedagindtttierete Thopeyeuilomenocy py eee de cee, Heading SO ‘Tee ae Simin easiness oly wopiicdepeeneme Sips digi. Inveuciom andra {newness ob sites pretense fin inpervforms Thsyere peor. 2 "iyo neat bp Choosethemost ie re erp of te arageen ‘ible werd or ‘Gud shweecin Safe apo toon insets pec Sumario ene ee Port vie i and aeolian presen ind pomtpetatin ay 90 Th ri Euepe camaro an end "Mtb tbs fois rai that bared bad caued Ueda beloen Hinorepeten arava nyo Ininlormal spec, pone are hho presen wo dssbe ps ‘Sey perl mete uraon em more mete and rams “stbw thor onenby bare Benne ber ‘diefitoneey a 1 Allg youty wire nhyen ede Brey years ming Beinn iprove my Engh, 1) lerame were on heel being glgetiagoec ey de 1 Ofeoune you Maryse yo! Laegsialamsecgng yo = 1) whathe mater hy dalek lang mee hat) fp Total Warand Pesce verong lating ove oe 1 fetseivm wiz you ay ato mrss ebay Baw yaudlcegoudning in eaeroon? 1) Tmgings buy tnew vining come My doo daft That herd ipl perfomance Wha bgsst mfiacoeig Wheel 2? Dirt) dentine 9 Whoeny ‘dotavedincar doer bong oe Ritchie teenberforiemont sey! ‘jDopearesise Are yooreiing 1 Pacts lope Bat jt forth weed ‘leone econ Teryninbel Hes ‘hu 3) bing 1) Threw shine itr fie be — ‘tsanive a) nsuing pp War onhat nace ‘dost wie a) dorieay by Laderand genome ‘Soane Samsung 1 Abe! 1 wthyoucomple ‘Doge Ham apecng 9 Pe aie Doyov want) ‘Sisal Pmselog bsp HS High rcs in te seats rings own sat Shem s Prrehetbia (eck the sti 4) Pee git Yon 1) Hey yon Wha 1B hineisouy ois ind 5) Totetonre 3 Youvecelyjaned hore How goat 3 Pepnomentansa ue He on ecncapan interwar (Gos wm willbe re neve et 1) hac your opinions Teor ook? Wha nth Tet acbor, _ 1) Nigdhepineropng Neen (©) te mesg ir wed? Whiedoa —— 8 Thenamberofpepl win wn bcylainccng Morel repel 9 whoo ey neh () Shas waitpid How mich — 1) New mind sont pe by Tepe hy Thersasnal fasion rom ') Wham tcbort had i) Pala Se age ce wish ny ake. nate how 2 enon) gute we We pend) msl cy topeersomehunesbcoe ends fcc manel my edearaso imeresingtarl3)- Ghnljolwning testo! (omen) en Wan forme Hee) se ‘coon deprmet Asean she) ove (go0a) wi Ree Balneaneof heals egress ndtey@) happy ogee Barreryene excep ee pyre) @) cosa) Sha Kesh(—---falwsyenlt) eqn Pane G0) (Geppenokow tt Seren) lite) Kesh cand pope ‘eho 2} oaoge al seine shelled anew Ie Sonsn (Seon) poo Helen He) er} Baty lo theowsendpaemen Rad ply ler mecing ig 19) 6 Rewrite ech Souiethe Sonincrly mote 7 Chooethe most Pree ie (000) Friary mesh mney 8) Peeyeuhbox When you(P) pe — ape tombe csc os hehi(t) (ope you slat Ba(9)- oan “theirs bdaethepolee reed sn png wiliyau shel yong es egos 1) Chr anhitaherrexy she Loos ‘Che ket ie aber a 1y Theonotecarsnsispuliepiedldebaléy. INCLUDE Vind Segre ———— exjoves «a beady igen sicncindebeasy MANS at jooropian andy ace pining TiN Wiocyow mda es sour a 1) Taming wie owe i) Fiowiogaar wi ors 4) workin aise in 3) areyoumcying Fen ole sete? 6) am otahing mach moneyed 4) Theloodtars were pansy Yor patent 1) Nenana ech wham by po 1) Peemasbs bem peingovrhiloes rales 1) Time raters ow a get Soor 5 espa ony siecle ok 1 Meoplcaalradstonale pepareceowed egy Ene 1) Foruaelhetabraceeceisepaligh Advanced Language Practice 8 ety any resnteerenin omen 1) Tm dependiogen yous dan many ahs (eer 1) leh te ew ads? eesti ied th need ©) Exeseme uta you wat for someone? +) Thee potatoes tang bc funy. 2) low we you Tsing dy? = will ges, Froee Unit 2 Tense consolidation: future time Explanations, 1 Wi nsoraly Keown sth peicv fared debs newnfas, erohvesppeinna esas" A blame teeing 2? Thecompnyellmatesprftnnee. Tillers ‘Thalia “Tare hat spat 2 Wii swe ocx miei deci ‘Mckee ° (the er ofedand shai ia ond 5 epsng to decribrinenionsorges Atte maméntofopeking ti ‘shaves ees mae Tig omer il Core Gongtp ste ert becca crn wt cht rv “aaah oe! gen fal Decne wit gig order toa ore dinantponinheoire Chherucrcfedandch ein nett ond 4 Precision dese Gd rangement ply el ane! ranpnuns Ate ene nly led 5 Camatbecwen ung an wil may bea macerolspeakereleec. ‘Thettrwocampein wold sem nappeopiel geo! ‘ted poly rte ee he cus ran pte ind 1 Thindesibean even which il happening tore pin. (Comer themoming. Wb pining ihe 2 ean deere vn which regent happen anyway rather on ‘sumshichee chore mae hen Toe bsertfiatineteeryou bene cain in (emer ere tek Fue pres er ways ‘lrg 3 Inve cones fae comin sounds orale hn Wilyonegeng te sap lacrIfopa tga poe oe pune 4 tana based ordered angen and plane. Thebond wilh pearing ln fe snes 1 Mishubotsinpndconinculom an onetime hve ‘nwo ea ine hae fied ibook Bytbeeof heme be ben rhino fore ye 2 lamin tee coger scanpieeate pt ep Yorworhecheaib eonaone ‘tera ‘htm aout een 1 tata be “Thisioed oder foal arangemets “Ainadens arto sso eae 320 Sect Unis an iar enprningstgaion. 2 betes od Eee ‘ah yates poate sebcict e ‘epiglte an wicca! 3 Presenting ancy Procnsinpc ied rela eretineinfareine les Whe gether ned Pract pee cananbessedinted of pee singe whee ‘ompleton ale nemnemphasoel lever vebadevcoetgrent 4 Sraningivsbovne desea ee hich ing ‘Wishes ofthe ypeaker. a ala Sidr we epee tar norsRdncae {epee ee eee pin hth One tre lence 1 hoo the meet tid 2 Patera ceainos ‘Taetbefolowey her pret or fetes “pet doesn peice a 2 Ofer flowed ysl ster athing ane lowed by wi heres. “Thee, ewe, ep debe Tagen alee Tebcohter United wl in 2 fuse Js aedt deere someting the piel ppg ‘ary Te ene een et aba ene 4 sat Thee oslo eon are lerene pen ceased beretiein Bish Enpibend oly desing eS Un ‘nd infra inerprg oben Fase apes salad feral opechond rien gage Activities ‘Thirst pte ein expresig etme 2) Jochnigsingsabesiy Sven month he sal 5 Quik recomespoteecr Wh lleva gang o> ‘Sebrkca indo? Helmand Adve weds arpaaeonsheincolepaig 5 Dow beseingeent 1) Thmesobebackar Socom foe inch 1 What you ink youTedeitalaudain rey tine? 2) Coneon esmoweon or lave eae he pe! 5) Milasabewading Wil you nad the wether Cesena ining vatigyou. 9) By ete) Ge ek tbs be oe 1} Dont phones .00 Leben 4) Ince for hori Sbrslring eas ony yah. 1 cTheresnomeonestthe goer “hath thporman™ Byte youptback Hay. (ere) iboats eibacnan hove hr "pow Smut emg? Wonldyoe Rego 4 Bythendoftemeet we (ede wha tod 3 home the moe 4 Complacech serce vith ialecerdor Pewee ‘otenretine 1) ko ong fore Dar Sith. B tveproueideredbono Now ete (as? i) Weve hotinbee hae 3) Whatcom ope) Ana forir ithiy? Hee you dec ye? 1) Pa ighisbaund bel aoogh ‘jeaniear6a0 dese ibang 1) tinoae phoning Boba fen te ‘le lewing sev) wae © Boeyonemy tare iy A}wegaigopinte Cop.) are weigh Cop. inthe Cap donegone eas siiwonegs. NTimocgong. oldest gr 0) Acerding the ae rec hue ‘viefinihednen yn) wine ied et yee ata 1) Youeanberow can ‘Dam otgigtoned anon hueheneetng, «am stneigt 1) Pncry ery yee ‘ingoingtoberedyina mine 1) wilhuveben ready iain ©) edna mina 1) Canyon send me hee on Atbearanything? avenging?) il area so ig? 1 Youn ty mg Marinfo ep ut Ato do youny pnd i dingy anygod.ciewon be agyau any good i) Dew wory borin youmadeecbdy A\wilooce ison, embers 2 By hone nyu poermen eee ened 1) Wactormehee ncn tack 9) Benson ~ cig ihede 4) Nooncrpedich Goal ae #) Tavtineone wet cote Bae. ca Wiley Ces vg ka fer eh 1) orion they fin e gti? |) Weonly pone he inatons yee you nn rece yrs ye. 3} Gzedbyefrnon le nenne-nsntoiolerinhenet 1) Ldatepponeyouhae herd heen Youwonthaweleod dence, 1 Theme Nine pec Tari pay. ‘TPs Minerva = 0 Ancw manger vio Brose pte sce Fa MrBrowsie 4 feeb neSapany fr ear cape ecnd coe. Bysbeendof enon : 1) Why dont youcomete ster dangle, Whydovtyousonetoceurwbenme =n 1) Whewedy dyouimendto det, Whee wegen mn 1p Taare bein habecs djl Fa, Demin wc 1p Letlewesehecdof selec ') Thewwilbencim nemo pening Tom member 5) Thaboskwil he merwayena 9 fhe lai 19 Ene ha ying elas oorcale nena nayou nyo 2 func eee ime 9 tinue nit belinda ce 5 Lanse Foy. wore 2 1 Baedlberigsentae 3 Teil na fica anouncenen arbi aemon 3 Byetornw he youinsna serine iit Deitewhe epunel seed Sask ly spine sires 9) Whiner Neigh? LEAVE 4) Peso etround and sey Wht dae te ° Whats tela hmesng? 1) Warde yooitend todo nom? come ~ : a = 1 Pregaraingidotonerow ide wing ic a ‘piper le 9 Wiest yurastanondiepaees Wonk 1 Us Sghenbbithday nen months 1) Tanatogs pony. 2B Mikektpe poy 9 Kiss cckepncmaigsialvhAR0UT : ty Wig do once hoe Have ‘tees geste 2 Filton unm 9) Menyougmhenpon ~ - 1 somone il crys 19 Nocneoonstoiig int wnat 1) someone vib ag lryom emer i) Saco! 9 Besdiocalatehec one wont 1 Tim gern apy ina none : 3 Pmesngageanpy insane MARRIED } 1) what youdoingnche ma 1 Wiryand Ain wedge wean 1) Yovealee tay A werc hig mg 2 wevegsingts hes eig. (beh cepal arere 8 Wevermoet ofl 1) Wharare we dig no? 1 what we pg tode aoe? 1) Obdeas broken ue 1 What ely mary? 2 Wharsyourmotergngiony? 8 coring tote weber 1 etrain tomar 1 Wgomgeorncomaros petsipland Faspeee ‘impeand Unit 3 Tense consolidation: past time Explanations 1 Paige geet CConpied tone gps hed off hai dt do ein ae ag Boer day et thar, Tethoe de de erating 2 Patconinou (ropes peel eet ‘tons in propre henner yee) es drkingmy fear ine. Whe es png ee poe Rucpoinddecipioramenie “Testeredsh offended rownd Mot pol nee twrkng st ‘Hedy bt netting Be indo preening rite nuthin tine Chegnget| "Tec neting won alee One of he beac at adualyfalng fend herve making more and mee Reps ines -iien Wiha frequency eh tsuetsniart these pecentannaoet wegrentenopine ‘Whe Jer a heal het ae gigs. 5 Pancomineour inoue deere pn hak ason, woe he ‘eco ecm mentored bore Pntsingle ted eng ‘Whe ed Lande, eed sbngb the par ey day 1 Papereesern gee er [Averett pu whi apes bore another eet inthe pa wre ‘Berna tieerpeniontab clen ‘jth ane gabon os ale Compare ie he rif fie ive before she ation Inciseampleceaguenc of ren ae cy befor. Uedioand vou aflied pt Papererconineu(prepeie). “Theconris berveen pepe janconorcnbe muda pereaeneforvnafarberbcknte pas had beng ede phe ‘Whe ha bes ang on oe ry hedge Theale dred ti abo tse Bd ben eng hee. They hee cooking ice for estar and ey Ith babe cera omen Pus peainaoconman nnd Set Us 16. Pan presi ed smpy to deere a vet inthe iat pas, ‘heer herp eres ey hep eich oe re i ‘Thro comria wh hep: TA my beter nna ‘i Tad orn (bt don’ ie) ‘Tenepefooincier cond’ nos ehangng eet mo ar ‘Therion prevent inerleree poi ould ‘Thsised doce repented son, ont debe satis shy wpe peso "Evy eek db br mateo flower: sedis nosrobepoitrhere Compare Tao herby fl oulisotpsiebre ‘Wali morecommonis wien logge andotmcccsin “Thee decribvensinended tosses butch id ot poe Tin gig pone on but fore. [biking ofasing ey yea ba aver decide, Tet aba odo bt ned dng orig. Joe bve iter at bef i ‘Tecsaing pa eve oben andetond ery gigi neyo (td's) 1 Chooses on ‘oiale wo ‘rnd 2 Drexbeebia Kidston series Al Semele Thoestecomn nd eonder em wong yu taeda come toch dieu Sette and arcnmen oath 4 Con wih pron pees Sec Ui for cons enween ssp an pent pees Pause showed expel tine Se Unis and Activities olay oo esha nr dt ‘outeeoies a 9 Tipe scsi yb 4) Everyone was having «good time, although sat many pe ledancedlvace dancing 7 | ss Sta ca ze | othe i aid ht you wer ing here 2 Iilidatandaeaen oy she wey ogy a 8 -Pallstgsenshek ier ecied eo W ikavbicomr ene dell te uadiaoung se What ho doe eg) = 3) Roba terre tech desided ives speci tn Py 1 icin ogitoch witha yer Whe ese yeu? Sage thenine tenis whet pan petra tee miler ‘Trend tment egy walt bf led i ‘hand in my jacket pock = ee Went" pin eens ——_ ent hr sbi eye 1 Pee terine soe da ba cl (Ginko 4) Nebady (wc heli boy nh he sks lrwecsloudesbeund = (pe) ia pockee oe potest en myambrcaonshebas ves (Garden 1 sce (de bematheecherbecce (lmayepictjnre 1) WhawerMaon (ino sews wo oe hoantibe-- (goo ptin by few onipmetiner (Gato) ur Sringlhetine re ort) tomy pebicdsmy mother neon d ‘sig erp Fe panded whe avon Sve pore Stead eme ane emaeoeppeinont Sing ce DT aon din nam oer rece eco 1) Thin) and sates aon ile romLondon adit (beeper ht heen den da Everyone) 238 ‘ung th oes down ro cela cand we) ai te ‘rnin teeing wo fore te nei ade Winall Bow) 3 o 1) Theciher ane thing sow ov msghbour Me Back wast he (wader gnawing She adil he sy herve ()agstiag doy adarson teeth oe po ‘italia e dae kin ero sn (at Leki hlinberbecroomt ial, 2 ©) Inpeor Gone) xatintoch ih Thame ley Faeesicnoths ‘etre Profsor Dowson) audsanpin bce the Presa ‘on ania im neni hshod ol ong omer ‘ednow worth Profenr sho ( dap Cre aad ‘hatha tepsbold be whene phone we Seas Ades rm Tame Vy Afsana body nthe Thre nx ening andthe design oth roto Mibedber) 6) 2 5 » 3 4 Pacacheabin able ‘oe On we ‘hep peer ween Say 5 eShewbethe neorbothefthe 6 onthe Sangh words ‘Thine yeu) api erinalng con endin Fancewiha indore Wed). ~~ (eet oon secon balay io Normandy. Nether 3}. — oo anes oreo els) alhnon ome Freeh coun hcl oe ) cnc eangsabrshupentrbss Now we) (onde) tna) econ We) (Gow rately iavne at 9) erg one Soran hing ce wexthere()—— (als a Sod ihe we ne leigtbe wagon Falvey ston Then hve mang are) (od oavne Step hilmy ket) -—-— = dente wed nd) (ial. 105), (ralninmednly at 6) ek) Inyarm nd erste onal) (enter ‘taney ome: Uneasy oy pana) (retry) mehomeforelrsighand (9) feevayon help S010) ped) sire copial ec done tenga Yc ch 1) Inboredaye say sudngeanlgn lnm. Gsbeppopsn 1 When! govt inema ch forme 6) Weald abasshsretesteabie bol ned ours, 9) Mary aasleysliigiaeaallilltore npr: eaaions, © My ser udinanafesldanasotore)ean ser 1) Pay noatentento Daves rerrhe e susie a's it Lean aterlush gata een mosh 5) Beedle lore hadnt sober 2) Therion a nln HS Seep one way bch om Innhndieighad nent be daiinget te Aone e Bet £ pl i Pie hh sft Sei up cilaeaaeas tose Sa 2) inendedoclyoe seer ors. Ueersogiocalrryerin befor, 1) Weare spend Sanday encom mrtg den, WOULD 0 Pande gab ong wl 7 Choc mont ced 8 Paechvebie Ceceases suis tem Oly o hepa pee seni 4) Dian waaay dean ae 0 idppy boi inponeata an condiion BETTER 1 Tock opera Use 2 Taiipnilygootbelbes ig was 1 isd pope euros eed dapia passin 1) Scunboated oubioe wegoaberboa aye TIME 1) ari ate momen otc epi HEN 2) Alacededrendthemul fond culanede compre qe Syteermerethns meh tf ress what a opened 6) snopes Claas ering ‘pte 90 th Nel el lord eae shred 1) Geresoay ee know shalt ringtone 4) Ivasbvng chest ohn hed 1) Weboaphourichetend ve mate lie tn sed 1) Acre Grands, peopl eta de oma hii i) Everyone as akig bt soppedaetiaeie anes Sethe 1) Thelewer sheared ade endothe wee Hany wetbch tothe cy te fling arin bttwavn some ‘enfasonSlies er ender (ante ound xing euien fomonepctossthey tere} neaen) oe ay poe {oh hey Jon) Hay (@)-——— overeat ‘amp belo biG) nn heer rth mon he tif) elit oppor ostandon heren sn hess Ferner He) -n---— (yop the newspsperbatometg (Gy (happen cheepone lines He( rn yt ind coe cy (Goeny whether). {plow vr becanp Ancor bogs ew aries yi {1}. ingyen) inn epiion offare Bongos (0) edn altwond im nd ever g {hq Te ple) memory ate Caer ipa Scie ‘i am eg big ‘ded want) it ena ane econ he Eee ern Andee Brn Cepean Prem pee sinne Pre pet Unit 4 Tense consolidation: present perfect Explanations 1 Proenpeesinple fe: Ree vn ito ine megen The cet yb See te oi Ioetsen spn Indenteces whch opened atanenkooeine inthe pest No tein Jimbaran the preen) Indl events hich may bean ines ne peek ‘Voted yak athe Pmlimgig) Wihsracveba ssa sichlesptetbe pc elo forte Abin ton nape ie pate preset Teebeutel mth 2 Conse wtp ingle anand ithe expen wih deine. The Tinea entedrandonond Compe ‘Rrbogiencocce tei) Tape aco ek fie) ‘Thogh bc oferall onda cr led abn) aegis steeped germ er, Teen alert goog eka Hertha best trend etches Tig male ar gig ah esther esprit onthe en beers 1 Proenpeeccomintowprepresn) an eos age of msi Acpetigon hein presion wed sn conte, ‘ASatemtch ipso prose nent eben wai for yor threw! Anincompiacss eke caning hw bbe ine ‘Toenphan denon een al orig Pete 1 Choate mst ppp ee cece. it Tomato present pre Accel ihe ity Toebernrannng. Thabo bot Arepedaciny Teebeetaing Fac lve th year 2 Comasa ih prs pressing ‘Therma belo wher somes verbs we ‘how ongheeyon ed beret “ow ng oo be ig heel Some er pci fend ay perce cosines fem ‘Thevemay bescomsuerwenconplonsndionpion pc ‘henuntr oftema comple ond Compleaemphuironscevenest Toetoned esis moray Incompetent emphssondsaon Teebecnroning my siti mang Meuingwih pret peters ncn withers opens Conaway depend ontbecascel expres Pssmplelrigionspecictine ‘ted late, onSeny Plan puting tn (ching of pidofime) ‘heady osteo) Many int expen are ot ied with pce Theories Hace Iw imran Activities 9 teeing mh Sie 1 Youre bopsloe ey aly! We dil yudlhne soa dcccs ening cee th rom? ©) Why overhaul stad atoo aoe Toorow iggeddbavetipad ov astnow andbur mal 40 one ade sang Pl whe ae? Lebo thous aetna pads "nl hela tn en regs 1 Dost logon dean Dron ora o Windia Bho Dsante Heavy rel nde exddtae era wea te denon hea echo nl i iene et forse me 2 Pach vein rake othe miepee 3 sesenceshai) Thm Teron Sige 10) Dorore sneadgrore Shiner 3) having protien wh Dai He ofthe nigh naling mis webs. 5) How onan ubalavabeenag ‘vk saunledesoatatewarseabeesig youre }e° 1) Yinsory heen omar oi at someto cs aly. (reine othe pa fre 1) Sofa nn (rtnte antigen bate (oe perlveydoveanion 0) Feonder Nagy ae She oon 00 Inetocneh eae 4) Herth. The Hore Oe —nna emanc aches Psnen the ne ftp fom Dane rn tie hr homie ‘nethensherp) oles sie 2 (Gaumakepyourminds What (yonder 3 tiny (han) Bome aberdeen oes heatramtimince p Remrardh (showtht Clb (oe ‘coe mei bh ig (and ecfinc handed enone 1 Ti tpg theca dof pose uy of etson propane hophthey nsnninpamasy a CGomeinghappen)o telnet (ey) ‘hough hago push mer BBO none ar newb be (comping abate 1) vencbeen ating vey we. Linea in 1 Leenks dei ye 2) ele eee ‘oi, 4) Dart wom iwcben tg. Fer inebig 1) Pocono ropes 1) estedonsideyos house — 2 Ivewared yoo tbar ae. Forbepen boar, ‘ih peke 5) Ihnen mde dion feral 9 Theron ‘heer dy 2) Tredenddeobelac you. — Ton. Somes Somes hemes 5 Rewitench ‘ees tonne 2 steam ing etn gal atch Thee beret thereat. by Byte age Taner ie 6) Ips ti etn eal, ealy Toe 1) Wehaver bering rap 9 imental ome Abele nanceofalbece Sica by ltowersoety ys ic we ama eke 9) Told i) Tocca deiiegrvemeninyor iy porno Dawns 1) Youkave nid shbeiing oh i as hfe ahead re. = ») Testacamtostopsneig cy BEEN 0 fuslsditceromabatbeeadbe Has «9 ise one lot yar ~ wave i “" aerone 0 iiteeayoe — HAPPENED, pp itaughny arated asap EEN aw pha Have iy Rcdcetbncberdcoay cabararbowe Mas 1) nye ible mast 6 Pato 7 Choorete most ‘eorsae werd opie Sdn a Pucechvebin fiber Sipps esecincor prow pee 4) Theprcespevelt 5 Roden see ie eer hove dy og ) Bredesen Wer ond Pec hissing 2 Don's hs oom lok cer Px gud vb gue one pop cashews 4) Dost dinpsinmttvcoutsdon soul's beacon anos, 8 Dreier ease ae tex? 2 Mot ya 11k hereaometng rong yor notre ade een 9 et ors paysite hiya 1) Tesbcnohming Te ghooed An tileaing terthorneorgy, 2) Waslongsineg ) Yvcsenbilguteoten im inti 6) Haveyouphenothe der areas? 6} Velvednthesanc howe forsee 9 Pradeep 2 Diam bogies computer esse acini, B toga panacea Defined ig here oy 9) Sucbough «CD peat wek ands’ eniengto me 5) Serbo a ewok ihe seal Evers they 1() die cd monet London. 12) (orn) wheberthedction 3) --<-— fa) wenterghione Rak (ned cy hora) (Grane ane, ‘stools cgay mind Howevevsnciben ot pene lof eave hig now ing ip aay soso Oompa) abo ee) (gro op)iataly ‘el wn and oan pendence eo (aaj wae olneins bic ada when compen (hee sob anon eee), (Grab ace. Buracordngion programe (3) ree Geneon ee nda peopl). = nn (pl viking London ree nae sslarecompane (13) cea) omarecesy onthe ee Ofeoune (8) Gamy pura atl mregoaone wo (cp decsn er hen (8. friend(s shche acca (2 methyl tteconpeny wid he Huse ou | Seine Foie begioning se shown sha Uhemeaning ays Unit 5 Progress Test (Units 1, 2, 3, 4) (h(a ae) aie ‘Bein an (crm o rw wayraeanng cone ‘he lnd Tht on” ial nt ny lawing edt bettomesane weal aking nye moon whch us Sethe cng Ye ou) n= here carly armel Mel tnandooe ‘Ga separ ons lr uring hepa ove 6 85 pep). (trmapiewch roceige TG). (Gather oy myth fre Betayon pond nd nnn) desk {00} ssn (nbebeve)iasseocs llyoutheth Aeon 2 pl visor bing on shop hmong tne properbunerseceyane Gt) Fein adn snares foun Bat ody 9). Ghat anything bart chart Mon people), nd ‘tei ene rm snr ney ee (8). ion terse and matsdathe (3) indus Yas ‘ppc hl sdoensher 8) (ic dover south Food) none (oas for tems eee {rh oop Th hep (con iring fe rumah (19) (noah ent pe thon horaion Manyratathecordstonime 29) vio ‘hed ocstthenes dingy therapy codes ee Famers wea) 9 This materi none of our buns Thsmmerdct or 1) Thsbidgewilabew eyes tocompee Inthe yeerine we = © Pasy rename alc Paoy idan «The ienAnaeforgar ~ 9 Redes 1 Alerig ein begasa Tah bear 1) Wethowtnlne inna ached ica 3 Rewer erences at ‘onthe ordinal nbs 4 Compeach seven than {fpropenemerd cpm. 5 hoot thease 2pprpeate werd rpm. 1) Hany eee wre hoe Bysbetine i) ihe nha pt Bl Born ee =— 2) Westie deteenn? or 1 iain ices er vover 2) Feeiadiociaaemsan ae 4) Togetto work ontimelinvevo getupatéda. MEANS. FoR Ia cor Sexenie” "BELONG Shree 19 Gacy hice wi erence" as Sedo a Hist Rea r0 o 9 Wradtdastncia ese 2 Canyon rennin ote td? 1) Thnithefnas cone ee 9 Dortensny cm jo. ‘eh <4) Thave hated this place ever. ‘here. 7 <2) Thope that by the ed af the month. allche decorating. [oral real 1 Sheil and Ke nor to-ench other since their quarel last week! — p Downennessngioianie choose serene 5 wecsgosliapttet tong ye 2 Tey nso soa snd up ver pine 1 Themoreoerny stolons! edna a esesoetbevhepywilaresare ‘Sasiomar “OU by Seine 9 Wher 19 Watkeme ine orden Mites Sy Soya o Metrablewih origi a ining Rie aan a shachooe 4) Canyou remember what you were doing. = » ‘iwine onal heyy Stine D)s000 1) Theney hol opens. ow aatance”enetwsth 2) cayby day 1 Thebes ing wel safle” s)otlngape Seumenly oly now swegcotheropeehii velba ‘ively One Now a) Atbesine 1) Waagere—vore anew deen comely fm eto age ‘Sane s}ehn 9) on goswinming ey mich Nnovatye Hinthovedis Ceanly_)nowsndapin a Twchne maneedtoid haw slekogios ‘beam "sOnsndallc}Fomery)Selr 1) Thisimy newer What outhin) oi? 1b Tateaeyons Twbndeyoumen var 6) Feat te chy What rego de) wih che 1 Ser The the ish bund setine What ns oud on Suds? 1 tdaeinowniartine wel I ew 1) Srpporedyouath ine beni let hat you wee ih By Pecovli'wedand what ed brn deed bees many pepe {al tone 2) jams you've phere a Enno ape ody. }) Benedoetiemedown sivsine I=” Goeehonyon anh grroonic bork (depends hen Hel 1) Sean etree hep eine] pe) oie SE tone eight oma 6) When youn fe gy meonmseice eg) You wheat anon) at Gini icaconinc he ckeipee thet omy eke 9 Seip oon (opnonacehe 2) Reon (Gore) podlooka te dips (end hem acho ou Tate oe you ee ae and 008 fico ty Whee. (tapes (oer you tint Paeveiin beaches 2 Brehm nn i ig ed ithe 2D Ser (expec yovbr! Wht odo) New Ya ‘Askbondrdof peopl wathey() pepe nen yeah yay andi )onn aah erly slcoure ate pac you) ‘ain (tonto the Es Pree Fan Ch Aah caged tec Ro 0 lenny ede Me errs othichome Magli ec ei singe ey oa} ch Fm Belo ae Calon ous Lode jah (iat) Grads rhoe, shee) on ljhtaan mack weaoypeiee [i Th fe 0) nn brow) ony feng Nes 1 wren tain Bere ecege tC ‘dade then 09), (ceriiamy had Ch ge Chand) gogeran ewan (dah otreing soorveemesiwinheOShecaye i (eeevatiiertsoneal tephra {het Veg for capi Jenay tactile hesionee sesh (9) sn) ene and ae ~Uoensceindayn (2) Oona cofiorrde rt nota #9) Thelin wan Prague win 8 ie eee ee | 1) Thibeault Eagan [ Tisvilbetcfwtine sone } © ety waterline, Thesswo Wego | 1 Thre wilson ne yous eerie = ©) Benunber of pepe vo send a cleo epetionn Morepole 1 eis a my wack ©) Mywarkworefnsbliy tr eal de noc ') Govotheineraionl che deka cova 9 ow abl pre 1 tetnow dP _ = 1 osteo ning omc Scealmenten shearer = a i Saleen eran Fr’ Compceech bemencevithone 2 Desde wbather cubcdetied thie cps and renee these nee Mercer nt) gre Tein (oesndend what you (et fo “anyoesc)my pes? far) se “(aoa by 603.1 owe he ini eb 0) gouge hi ween OF non onan 6) What feuthia you —____ (eaten ine? 01a jena cc moment ee at 8) Samat el) neti you oa etd inthe paon nines 1) Whatsibemaer ee oun you ale oma Goto 9 Tht elaine edyousry mney selina gol Chine me 8 Fay ough Bb rac, Fev yoncer nn tdeniaiseoecnet Hovloge = vaiaty inten 2 Ree —mcmyneehcna 5 Cldynsbowmeie-= Jorma dato P lpomtetepeeveytingeiy eects 5 Hyeotnthd enone? onyovucitwoer ed 3 tnwey oo vebasngwlng brea nee an Bunga 2 Iona lyon) Theda wlewiyon 9) Milyaubestiag Rob ones omarion wondei'you col ein ‘nesagelom Sly Corto? 1 Tad et neo Grek ed Weston salto Fagen dp : 6) Ji hi tbo Ese you. ve gorse goo oces! 19 Webadatetleineloking ser your 2 sot doe Neb sloely icin Mai Ee y wee aig hey ‘Seowsng eee ga to rcng 1 Theneamenge ama howe ct laelymadeniveaton ‘beGielstaaakindofacsmenpincioecoertney 1 lather one as gram arher and cy rd he wash sigof theron biceps 1 Seer leshrtedi wha oie 2) Thrratialy ing sol Aegon geteueinee Soa 1) Therein my room es bread hres meat eo! Youtethemunger what salseudg beats 4) Bevcwrof stepaive Unit 6 Passive 1 Explanations “The peo who peectan sctonins posi snecseidthe oe inode by by The sentry or ayn neo, persevere ora eae Anabjecwicheaesometings appends nue, ‘nace by ‘eon the bed ith hemmer 2 Mas verb withan oe rnin we) canbe adept Common ‘erbnatedin epee ple ‘scomefibethg ie et be ak the b t Someversbave buh vane dime any Ueariedabeordetegh (cat depose) Ho obese ened pesca aie ma 3 Vebswithwoabjes ‘ers which hermes can be made pane inrwo ay ‘Ontersomabe vedustnegeste ng gn pp rom, seed . _ 4 Yebwithbjc and complemen Sine vebubaes noun rice sich dese hr Helen capri on Evepateoiderd inane reo weep clos nl ser heh Hewes fare 5 Tamtion ‘Thess eh psn Egihandinather loggers ees shes Some lings myc pis orm sesh ei Altupiipouitet fons idengol aie ee themed ‘eprom sipleundontmennpnglind comico prac ede pl an perc npe ol ere ida pes Thee oracles angeadner = Secon 1 Cone sys lemon snyosbeer Chngotions ‘Thepsinecan change empha sence “ek wen thei ear ot) ‘hep wat won yok Gon cherie) 2 Unknown gent ‘hesgenizer meioneifanoow ‘tywalcbu eae Incite polt adding ney ombody" 3 Genennd sgn Tiere pepleingeeor'yos'heagetzne meine “homed nthe cy ied palcranpr 4 Obviouaget hese seus orbs shed en reno ination “Lndsba beamed! eensot yep) Theeompanyepedtoorrquotend nectar pekweepee 5 Uningonant set beepensetinporrto the meng beens 6 Inpro ‘Urethane wa ofan the maning apc enon he ‘reponse loranaion "hw boc dncddoredce leary 0% Indien of recesses seo peered ‘heron ante rople wh parte "There pecks ee packed to bese of yf Activities 1) Alcofhominhesre ae ben big broken iby berg. (bese Ben rete) ') Artcoveouh feoulseede held rod wuebig, 1) Tespoe tele wt tane brn deere ow 6) Thee snohngmresmoying tan enim whenyuste ‘paling «) Jinmarbeanensbenack emienewob 1) Somehow hot my novia my walt ad bean ingpeved 1) Then shopping core wa openly tac MP 5) Haryinbecrguetiondby tye abort xelen 2 Bethsenensin sachporherethe Compioete 3 Rewrite ech Sos ns nin ‘Beers Stdndand sovhteonsine sie fore 2) Alo mens ae en el ttn hain sided ye 1 Latwehitsdccdoctoane meeps 4) Mecowd son in ego esa eel bile yo 1) Thien oft compuer pil woh ef ecu Sette compae ern temrk bcm sili ©) Saeone bt sogedthat ie shop stot coe Kove tthe shale 19) us catsme aria ee you Me Sih MrSaithen—eonsonerlowurnte ©) Thewsien wiring yor sins oman Yourdinle some, 1 Sameosewed skit open indom Thwindowsn- hae ‘You wea us when we ae ied desing with oar compe ‘eyour coi -yateil heron 19 Anamonneemot ath cogagcns spare elo paper ‘Therapie neal pe 1 Neb erred unig Deg edhing eens Devdegn i) Thy pS ape bm 2) Sanath pone ebook agi ee 1 Theganmmet hs amoonee tt pra pcan ©) Aularboke i our hoa lan wack 10 Beside thew dng Tiel pieikbe peey he rng 16 ie then di someting ~ 1) sel ppiebed utl notpoven 19 Tie gvrameat ped ih hoped changeit 9 Yate psc fom i ep dasinow Chaagencoo tei 4 Decehvetin Brckesiote Sonate 5 Uaseioey wrath ogent wither 6 ewe emia stowed 2 Teboxe DB Yowrldonscsn tape 6) The ipo oe ert {) Lothiy by hetine we three pining (oot. ‘itera 1) Wetadseoonhely ease ourbowe = 4) imal hrnes eck ng ‘cach 2) eedaa' hry the ce ‘Gatdby hein wegbere 5 Alesncower Gone wipes or a 1) Tesrondgal ~~ beareby Hager aie 1} Teese (dha thefoureent cer 4) Myientey haben lend iie! 1) hasbeen dacded bythe shel et Wedoesdy wheal ey 4) Hany as pated avery someone runing sexta bine gre 1) Thegndetrevangra ya ocur wert te Milne, ©) Intl someoetar you buves any orscompue oo 1) Suet ten pkey eel for thenton em £) Toeleerseserby portobello amt ) Teleport warped sine hove emis ai 3 lhesbeengreedby rye a smeing shoud bee D Aslurieduthconercnrs mt rahunal ome by one he aga 1) Actes George she motrin there. ‘Thematic Gergen a ee by fiend 1) Athetine my syst loking ser hen or ‘thesis or crn, " 1 Thepobelane eds doin lthewone am 4) lewaraminahctocncr Boar ita Dues ne 1) They idk woul har sie ca mac oock 41) Joheson fit became member of paciameot in 183, Jshmon wae - 0 Mya eeiasld toy yar i 1) Nab dined eam te uy ich apc hoe “ i) Tony hans mot oli 1) Theres define decison ye about the venue a the next Olympic 7 Rewrieech ‘nee foraiye Spusnefrmel ‘Seword gen al 8 Parachoebia Veh he 1) Sorbuewevela youre Mistay nfreay erere ben mil. 1 Tepotie se glag Hay downsthewnion. QUESTION: «)Tinjvclound vem fsed Rosas vase.” DISCOVER «Yoo pehecabellirohseuse "TER 1) They sopped pay thectchaerbllanbout””~ ABANDON 1 Thavenappdilc romans mAN ty They cok Cherocaen for dng dating” PROSECUTE 9 Yocunaliyatdinhndeiakeibzwhiewce ~~” seRvE i) Tasctisowyoarzmas ‘nsTRODUCE 1) Nothing sense eof Paine sincere 8) ‘hindonedseu Newbury tatoo 1) Avournew ire (ive oa Mody arsine suyathometocheck ae [pt damay droga «Tene Aletha tye lerhenspe"Ceg, (wae dawnt ‘eer ee 2 4 Foethepanio dae (rien) 1) Tala ae! wer ling with end cheat ithe (tie) apn ce the ote (eau arb rope oe fs otk ecu (cow potba bensfthe erences sone 1 Armjornew dpe ne (coe Non Se nko bene ee eect geen Fel 1 Fire of rue ah pi Vers, Cece yey Iromibeoarrobe Eplre’whch Ga) yee, (rohin cl ey once, (ik apse 1) Alngesom =n (oh Fondly esetchariy concen but Shecyeat 528 our i) Nodeaion ketone pienso ab ‘isiecnidwc fete), Hevea ela Pave Regring vere Unit 7 Passive 2 Explanations 1 Heresometig dnt ‘enuranly doe see reformed ory someone oxi dmg rtrd ‘ncn dens somthin lore hat harpento someon Weheoehadenrcr aterm er ard ‘nappertarngetteno ‘Hahcig ny ftp ek Tbreitene rere Sie dae re evn theo pred en ape oct qaie cen cologa epesins baesoneanerwoe. Inula tceisnosme a erie "We had ndodjordira nigh 2 Gesamhing one Ger nor been besane coment hie Gets ‘Simson berets eng a omehng mabe doe Tm gem eortere. aso coon nore diners: Sora os “Tesco ferng of vena manging somebinginsome aes Treen gate. ‘Sete gegen cio 3 Thegeeiohvessemisedoncanbedeenbed whee ding Yourksrnees ening. Gtcanbe stein ol boom he pase inpken ng ‘arin tere toa ath ‘febrile toy shin ich report peopleopinons Trostecnmcton ken dio ovadsweaknbeamlio phe toad opson ‘Finger terse a folomedby epee ininive ‘Mop Sn England nth cent bei Engen Vet ih rosie 2 Pence "Wiptefrencehe pie flowed y heel patie Prope blero Eg wee Snthis bend hese nda wth » Papen be pointe pre penn fom ho stdhapni heise a el than pid mc Scie, The paehnpr hea wand be Tete warengwilc bn 4 Wipers ‘rere hows prio pened by oe ‘Theporatishawen ave be peed yen oe 5 the arerwosbjat ceo ean epee, Theprna shaven te evr pnt aon Aslan knoe havepetce parton 6 Coninuoniine Patard pres connie se ed ‘econ eligi Se Thediertthngh tbe bending Ue 1 Enlng sence ih preposion posited asenene wh pepotnina semen wheres Feaniond eb inne pase Someone ror oa ose (Onrboe eben inte Weisel ser price hile pace owed oe Theat pecker emake Tintern ak ey evs peel pe “awemubebyshend tecetee Dect h bb po iki) 23 Mates flowed by when wedin se pain ‘My boumedeme work ard Temas cok ey bo ‘4 Gro and vet whichialresiiaridey ch asnroend dentin ‘sath ody Caeereansoelallowedoy ie coment = 1 Dace wheter bev Shp 2 Dacidinech een heer Served sean, " Thepueisproily marconinoniwritenBogish sheehreends eset peonenceamecontns ane beasience maybe 2 Poina memiondin Ui ‘Thepuseasdae ching oc ofthe sens aod genesied Misksandtamesnataninpeon!vircommoniadaespenerot pocovorondancenbic rock inspngeln eer Activities 1) Sento peinig urbane mone ” euepinnngentnoucarmoncse (ie) by Tedeninispigtottcouttwochny ech tonaron Turngiesrethukenontamorow. ame) «6 Sones Maysonet ek Nay nd solar mortar o “OS 5 at da yout? Tefen beth Wht you ik? Sonam famine aksotconet wrap thio you ° Ketamimee cio dioptoryoo Fhecrba eere eaoe 2° Wivntinticreeon sen ie ty They coins inne rere wet Werepangnsyes wasrionrsentree 1) Mol ou ener vn plc rey oar owns) Weld oncoming yur soestoed by psig? 4) Resid dace cater ‘Wehndchecke he sirng wih gud deci, 1) Janis er bandana 1) Ualorasey myo ae ile inthe ws 1) twenty elgeytdneaeend {3 rom ai ese ous tere 1 boca bot evenly da se washing machine repel By Sccapeopl sags ehnd whens bon one 1) Wehnchutesallcr mone ens enced ep a ewe ech ‘genes Siemon Uhemenningayt tenme 4 ews cch erence onthe Serdincp 1) My dow you mateo sees? 1 Pal wade iret sere ad en paying foro Sve mie. 5 Helen daigrberbourepanedly are 2) Rene scsi wed a Nahe take bee ae » Beyeninomt nn a pd Exige ne «Een niga eel Tepe a Remy kaon il ins poacreien Scop = «9 Redcat 9 hop ejr cence Onrtteper ° kien icine opener ‘chien 19 kore lp tw any im Thethip nnn ron 9 lho ed non sian cb “Theewoinjred men. a ee 7 i Tretorn coped ng wpa ‘The escaped prisoner ..—. = . a 2) Webelevedthegoemmenuspepredapin NAVE Bess seeped, ') Wearethikingolgingsonecretaputsheouidecl PAINTED choos «) intbeeadT scnbleefndsgaagetosenicemycat” GET People een o Thewanelsdesginodiclromibilncebeeny 17 1 Thepolertowedieay Ababa cor 1) Your seiciing cer y Weepocbaei pail il nee 9 fips arming eval Nea 5 Rewrterh fever tit Saree Seovindrine 6 hoor heer ‘ppropeae med Bar sey 7 Peamistie rreponton chase 1) Breyer hough Heenbaninedhetnin, TO 1) Anohercongay har taheauaror compen. ‘Qarcongry eben ike. by Wesredesig ih your comp. ekonomi pega Sonera ape ela oberon dose Beda hey dpsed 1 Tonto p Weal laa eaion 1 Weallowegansay seempochew nko i) aaron i 1) Then hoping te dong Aon iB Iielpntfowacomelelotion eo 1 Te prcect eco ivacldeilahe conf eho. 2 Aihough nye fle we coeredbdinm now {© Theteom wicammed gli omiareof aaa 2D tweeter weedy nce 10 Thelin peel of any Chie on. {i Teteckon qi round! fondah ered alee 3 Thewndor nbeemhed ssh oesomie cle i) Thesis puched ah cen. 1) Thewechdbeen dered clove bale 1 Taanowe harebenle thebok ©) Ariba msch nsec nn 8) Tain east behind ety oe 1) Taehossewabaltens money i Daido em bs 1) Thecntnromlyenapedbcng ono te 1) Menthe ret topened Sorat atric ying 1) There waren chan and waver tty 1) Noone Pee kadninvled-— te ivenivion 2} Whentlevhecin my poken we comm mas Advanced LanguegePracice 8 Rew ech bein 9 Rewrite ett ig epaie we pone Indvotis woreda Senet 1 They hve decided cance se th Ich bern dee cl he mah 1 Wethougl eas ory tee eg 4) Thee iarumour chat covpleeto ek vere 19 Thereisconfirmation of Me chscaiveignaion 1) Webeteve date ships nk 1 Mass propolis new lershocdicnie 1) Weide ihinkic wana goodies 1) Wesco X = |) Tharcartcns seg ii sh ‘Nahas aww cc when soa iene gunpowder Page how ‘ct he Chios aderchandfrwens ongbcongenced ond Ete hch creda igang ren ‘tet: eerily beth gpd troup tose he Age Gina ananewhsecmaog even a a fax pedis deren res ulieateenenny tay ‘se gunpondr mi niegeenoon shen geal it reduede a deve cre contre ihn euler mhingfrewoks antic Chneea Nonothnconeraly Unit 8 Conditionals and If Sentences Explanations 1 Whats ieas te pro pret Tothpese singe td conor epi srfmesing we "few ue peroed [Pbecae being emeanhefood neeyrady. 2 Whatwataeeye ep pst Bodipensinpl and erent oe pores ening wh ‘Ween lensouiyyawaron arent weayeda hme 2 Reino pee ill ivewe thin th oncomei cel oul foo digike hr, othe cet 4 ypc ins p+ wld “Thea ieiay Sato ‘fine tanned “Thevebe wy uate ops Chup tinued nee pech Newhart peron ponbliowrsboall ntadewond "liebe hi Fld boa 5 Hypo pusiuaions pup wouldve Taner pane ‘fihad ie yor sr comig Fauve mat ocean 6 oho ‘Pon sons inthe pret “gouges yousbold cone your heim [pontoarealy can deste probit, pte. ‘Ftd hemonen Foi oe Hyothenapessetone Jpouhad vomaded ne might bec org nherteern odin eal ‘Thradd empha hypesal ations Whur evenitese ere alr The preteens welche "fon hed eng ie? oy br drank mach hi wean’ ec happened! Unleranther server of nls neuen ot Nos nein fetes cn betecomed ‘mo ania seecee "fm ay ae ec’ eee oem Unload ne ecu’ ov ho cmb chaged) Mea dos ome bac eliotn fart cheng) ‘Won stnins depends on ote fen pace bya lange Prd rn Se Oi fren dobro provided eel arnt informed. Even ders how meng wilppen seer condo oenftmin elle foregone Prevent hen penny pees eld ‘imbue mise be ple wal ber by os Sato pes unions ‘Ths "ere bt many maine sees hiperbageo Saline theta neh prc ese "Yabo brn towbar, Ses e caer wil ‘peal a oing ob yu heendebevtedo enintnd ei Tyo reapoatomate rouble ve Wes cepo Presetpeete Thinanesedtwempbaisconpeon ser "Yoon hen oe ‘zal ponbieintoh pant hema, "Tecntdsor ony Pectaldoncbdiedtines! Desbtand wecminy ‘nadir a enbesédedinformalexpreiansnrhing dos Tht Cmphuiverheuncerisy ad Cos rand epee ool’ besmpriefieaie a hia wl oe) ‘Theionuiatavon ihre some andr’ Olieremect oy 4 Silt ‘Mersey fan vente, ‘fpoubeld nd col you bere! ‘Tininpleraet donee epetyotose Aen Tiralomakeraneotsemmorehypetea. "Plena onto what wales? 6 Happs ‘ete chance posi, Wien dhol “fpucbepen tne len con yocat ertcame!” [posed bpp tobe ping dp infor fe. 7 sfxsrastihad' befor ‘Pincrcrvs tow ont does onanathes "ice fri scope ood eae [Pihedeabesfr the pterer United ons eco 1 Witund ond penn and empha ‘Thorsten lore ‘pointer Tf Ms reise. scree or cmp ering item ‘fpovelny ttn wander yon ered iso) 1 Suppingthersbe Sg army ca reef inn vey ec "appuingyaroon i fetbipe okt woud yor co therm ee gobi erendel eer “Fpnbnt genders eo ht ford Thora tins ethos Wes theefond sowie ee Bolspenerattt inbeapeeratetns 2 tne ‘ratte sme notin Te efoto nt alate bile 2 Prccvbin brake on sop 2 Fewster sere that ‘oma he Sordin cas, 4 Calloqisloainionetip ‘imperinecan bee insendfa fscinevevay speach Stdownandmctensscrefee pores | 5 Yanda hnapratonchufcamueypuisispntoonihevebte Winaereted, apply within. Ifmeceary, ake tx we | Foumalyfeanmea ales fs aciva Therom ate fred lit body ca Activities 1») Now wee toa bd writen dee ori down) Maya, Row bu rte doen ori dwn May ——- nhs ate she) Better? “ Rast iSite htd cin te imi en eit (ery ont ec 4 Tanto os Fase rather ae Abe) ded for certain? ae 1 Fey cen yonsy mov. Yooh titan 0 esa silendatoree mad Destin Hyon on edo itt BE dntyeu nmap ae oe 8) Wealeey these tt ogee a wate ole valine exp ny Sena aval 29 Whe gtlnpe on wena frees Saino 1 Debren germ go eng (German epic | A lyoedohuceysinctencodyougremescing? sou ‘| ‘enone eyed neg? 19 Weve goanyeveaheaio nurs 9 ist iareteary isan wouED ingen hadi ~~ ony ijn ap yocwanitac ~ cone 1 iy edo maya were 3 Compecea Seoee ihe Matieword tse 4 eerie ie Kec 1) youneinLondonby ny harecomeandiceme, HAVEN 1) Who jon wealdhine Groner o been 1 goin odin cing ous cour ould! WILL i) iiss cin igus Byitatednee ik bch pes Fy tit emp (9) ie reds Soe reer 2D tyr ea her Bleich en Biter dy ou woud youn 3) Thana your bap wid he de este 3) Baebes 1) Workingt mucha you sie. Ne sernmach zw ee rking moc si ( GG 6 haw yudifthe weenie? Sag ecekeere 1b Weeping oon Win wos dol volando bal 6 Waar esis ss woah dod 1) yay chance you find ny wale cold youre kom? wile a wane (pe a Teli cabegi od ome i) Dickisin prison because detective ecopsised him rane 5 Rewer comets Sordi 6 Rew ech mings shown otha tremens ye ese > Betakpe mda en UNLESS 1 Issn alenoupoo ah esl TALLER, Tet pining sacs 6B ap 9 ihe wi woldjoodes WERE «) ifyoosoalice wha’ ones lnekoom” HAPPEN 1 iyetisin ecard iwaldRne ghey BUT hag i gad icine =u 1 iyosinion dking som fesancyouedi wnt 9 Tanti carson yon oy © 1 Bante pir weldbesog gene 2 tapi ou pena ly orem bebe 1) lene had ees wh snd See a pS. Nitadgy ecco 9 Bylo ely my youre lar ® igouwan ya hink eee boar buying ew ie 9 Kvoimaleany deec fC ar ineiedlnafwa Unie aioe eee 9 Mian ily Sn eigen 1 Pvilel our risa sane ig epi ikrn ‘Aslong ashe sudience babs Conpleenh Senne selene few a Dasdewheher fomimecly oer ac by tyousefntonop eng sven you catenin nhc. eceendea s 1) Wihenyustsn i vodlchavlaund bow Tyee 1) Gong op sy ma oe feiany c 4) Myouhad aly waned tacome yo cae efferent Bynum a ‘erbing bk bre Srey. Oc phone ied ce phone wlbestll ‘Diphadaitie ales. topaymerbewbae snout ina, Miers yootele wold have benef D tyelbuldeyouvee coming! ———someingtoen, 1) you ookmeretineoveyou beck ory seria fy Thesis sedi iy 1 Hye ied Saeco bee 4) Ruchadbnows bra weaning tbe sonechese 2 lyeuhrest cradles ye goukinen thi, ule B rheebeideewe mit 8) sro we goth pote coreined Shige indenon weno pb 1) Myers hppa change your rin ope ne 2 Mewum arden ve wel avebersbonety nw fipowrl desolate wonder phe ee opigro Bilin yectercosig twouboreme os teen 2 buteryuhdpedenonteasbr hen chong 3 Meier neg stine Unit 9 Unreal tenses and subjunctives Explanations Fhowncloteted sloredvoinenral Seek ‘Whine elf 1 bib once ging. 2 Wisereere ‘Asincodin seen ere ce sed oral peo ob, ‘ough earismoreaamonin every pec ve ‘Thee ies where you wan ache pcsen ie stb dads matte dons barene toe) ‘thor weve lacy ovale) 10h Feurgang on bolay etn asst) 2 Wound ld eberetiten cert reece theatre West wold cca ser wish Would ee an deed Tesh os wl eee 1 sib eoldame ow bla wih or nese ‘Thee wihwanldir shen esebeanarnyioghaie "eb oc won tmakemcb ace Tha withsreorngtpant ern whicheannnbe changed Te hater mah ‘hiss common aon epee Seti 4 Hope ‘Wie aes ‘hpet der itr ape bt sep lng ot recede bope Peeaertt pede tloned (eae Aig Astoesh Sapper 1 drier ellowed ly pt temesinthe re way ihe shot ih peas expres pene plage shoe Tauber yo die mate bre Boi drahersd one vr wth orl ese hen company Tvether beso then ese ret aleber heed hentia th Asn Rae pt) 2 Paprferanbewed pr scondonl? serene Nott pele theypeataeeerhaan cde Tapert adn per arfowedy suse Tpefreio ce Tepefegonttoss 1 Resende Thetec hers dopndon whith comprion nto ewe ‘Heacran hewmen barge (mtn chy) Heacs anf heie che Heche) “Thdowyes a conereahboudy ered compro “lacy ba teens! Ines serch therein ecu dleence mae 2 Pesetind pu edcece tebe ponibe “fda wrefing mnt) etnfen core ta bud btm (dds) ‘hecondcral purl hee setnesfenundrsood botnets ‘mopar ot poo! (imei rer seal dof) ‘tgp manele tha arti (bar wold poe?) Aswithconkonetecn thee rleresto sre posh ‘rtm imagacy preset poe “ppc tsirnseine hatte tat Procotand ptclerene weep, magne Ener et Srp weenie Wafer achnge Feanal Schone 1 Chooser peandwibin sone 2 1 Taisog demedinge Ne vbrsachat demand i, ge eure wield kigdnn,hebjancive may bese informal oye Thha oy one {oem ohn nd thar rd pren hor oat Tee ‘eb eharbetoral ome They demened hat elec once Teese presen ah innan/nningoran iv esetil chat yon rie bef ic 2 Lewforalunge tarmac be ed andes ose chang mde ‘renin caressed “They demanded hat be sold lee ‘Thoydomandad hath ef tral) See rye oan fr Theenfined presin a wing bine. ypc expla “God weethe Quer! Sethersamay Come what my. Activities 2) GBMinh eyo spinon 1 thepecah ewes. 6) Thopeish Teese 4) hopemih youidathne tog 1) hope mish you ap hung mach, 4) hopemih ning gr rong @ lhopeeih twenty rg. 5) thopesh yooenconeeo my ay 2) Thopemshyousor' nina 3 thopenih wecol ne nex mek 4) Tmoldsyitwes tie youd rr) woking seriou 1) raruberyou™ =n (nt wach heeding 6) Fw vnesn pnd) mretine remington 6) Hees sony hese fehe (omc pace 6) Iwahyoo ower) conn cts 1 Soppeeacompieseeger= ene) yous lt money in erat feat (goto yoerpary ste 3 4 Compe soem Slevendor 5 Compcert (se) nnn plese 1) Prather ya 3 Tegan demand heated (eee 3} yeciairpcartay toatl elaine 2) Lh ohio 3 inhale nel Stet S)feibtermsmntite 2 Thscaeenetn ecg 8 Seward an vc son § Sincshnonnt tony Stewed 3 ripe esis on 3 estan denny : 2) shen eld akin mh ser ight Ree etn tien 2S Gear enn a oats sctlliod ohhwees==-voiheGdinned Bee ee cand ces 2 Reith anette Beso ena Pieintper carn 3 TSpele yu make yo ond 1) ih ie youn ke yourell eater ee om 2 rican by lpi OT dou sume hepato 3 inion nbn obey nage Aan ee juke chine wing “icyltoedyou orb fosapig Sree 1) Fete eae rid Fe youd ind my posing ee ‘ 9 Beyonce ggg sn wisi, Rivet "meme, Sek wi me ee ee ~ pes SY oieieinteaasa ren Reeth a jkdoactincw iceman iaaitcpalia” ACTS . +) Fdloretobeibiciogowithyoutotbecpea wast a 1) Thi hadlhaoldpiniag coca so eseitcbc editing gran 1) Toemargeneninindonorvaragdatint WEAR i Wp dopo scp a wis D 1itemitogeedsoming RATHER 7 1) Ihwoukbe sce abe able oy | Rewtecch —” fal : - femenee Leah a ea Sommoge Potheyen Aovassin —o Evoene odie ken cd ele ‘hemeingsays ” Benenenpened a theme 6 Ufo Tega soa Ine enero 0 blr yoda 9 Whapiy ean br youre 0 Werelpmandcen naga ~ 1) aap yoweredingso fas Iihyotn 1) Maybe Pastas Tong ina Joke crit anyhoo ag one ekwouideter aad 1) Iie fon eine a {ist aint 3 Seek dc Faby 3 Penson Cie $y nei oa in ‘Syourpoytu to beny malead set eh wha appee “ddbouthtrolem we Sc fy serene 2 geen shownsoiae Seems Unit 10 Progress Test (Units 6, 7, 8, 9) ply proenigs plaedlomr fhe Mgt cess ftry Iveteans ren use tery ines Rone 0) (evan wekshrpraduin shay where ot 399510 pole (Benn emp 9) nn eater tothe Meperpin Lone month Why xe nt infrn source? Web) manne (oul) ibouibwo dye aas dM Cle, epraing he wenirsessbutine compen ches @ ‘ear haking bet ow ne commen) (sect polcs Men pgebanuebyieghoures om) (i mongasepayment ay op) Andow are gig eh {jar finow) Rep Replat). == (ak) ha (0) ajohelptn eh) ince end "Them aor employes) (oll wart ou pln Linon eer repae nee on) neh Psimoah aller reireen a hoe ogy When GS)nn-———(quesonfabomny te werken (i) ‘outdone eer reveled hath etpany (7) (proms goneramet sees hep ay open teas ise Riana ese norton loanaesh Soden hlarethe onpuywcvedoneau ben Uns MP Benseone (neta ‘erate manera Howl Common rn estate (G9) non nanendtotbe Mier apo inh ow, (vey 1) vthebhthe psoas cpr whe diking napa te an Seon rkeimojab fines eh enc doa oo cio Fara yo - 4) Thewind waded jouneate psn Theyoung ie 6 you med te iba yo carey ay You tnd ha Chia 1) Eveyonteiqed athohoow ndbcenal » Biseoudynahijeinsonah 1) het hie fiiaig con cnt tere id mete one saatirved ewe 4 Sum Sodio Tee See 5 Rasuhvein rache n 1 Weapirtampsingnoworktomoro Tei 9 Bg ootintepidreo yn 2) one hire ihe tthe ido 8 iti eo ee Tear preten 1 Toone ine eid ifedkeower ih Tacoma Batti men a Sihare mom 8 Rate Pail ~ puter Alder inane Batak vouch ts ceqestomares 2 fnisbeng oe w hepoeenaron B Meee ‘eden winewesyouse? 1) Everjonesioodshebook mr mivenby hepnerbel, HAVE wy Tatiieaticsnmy own Nts Twenty atin eaceerardaitbery nTwccncactiloelahwebentareirnicleeng co Hycinisa cing lcconeyougatdieion. WILL 1 ii yoosen pings pa wast pp SooaoncpenbelSinindchewsicabliaach” GOT 1 youicodikining mane wha wold yond were 1 Fh apedcljicootacesewwomsider” "BANNED. 1) te comer eagand celles wn 1) Tesco aie Howse Hotes Bynes bacyooso jane = (Gomeio ewan (ootexsthefood 'mbangy! 3 beewdatifges (ous) beet ene ys {1 Tune aacigoo nooo ot Frhthe works guely. 6 Rewitenh semen hati enc conan ‘beweds dna ‘ethene Spel 7 Compe ech orp ia a Rewrite wepiannge shown stat hemengeays Tren 28 Muryepertenes at sheila 1) Carlnow wiser she mary}inachareh 3 wn tertoeryoa 2) Untoranay tomer nah ‘ete 1 Mesioom theres sly acne orig inet aug cnc al ota 9 Mikki ec am aba 4 Tiemann as cddoedce te wodanay om, 9) Theda clad tds oa ae 1) Tagan noe wh cad ec 1 Yonica in apn fornia » 9) soi tical ernggs nie inlo 9 Apa dred 7 = 3 Hamtsing soci peter nn youlerenione Seige ago fos args 2 en otra SS ria 2 Jorinagin’| B twin ether! 29 Monty your cj ing mene 2 Mey yee omen any eg ecy weave ge 9) Mrou ay meta theoney youth won el epi Rygfiteh terre tena 1 Tbedicovr afew pis tigen Tsay fa hi i pp le 9 Kerem any diferencifyou teed nes ln pound ill ile inpion oy 2 Conca ene 10 cedinah 4) peromeonee pr your nowt 14 Everyone knows that aking exerci ood for your ea, 1) Breodisastarbreaoe famous decor ow her sca aachool play Slamour 1) Someone haope nani mee r by Theean appt ira ous i) Uren bigs concen loom —— 1) Someone dae ourhous on we Thnker a techie meting nd baer b teamcteae = ae 9 Alhe iing pape ae — { Fdrater yore ese arc 1) Nothing ‘Scenes or lng 1) ewer ‘wewoud are goes fp near eee eee a ‘in wold bae syed hs wTathebck of ou ‘yb splat wad Style 3 Mperyoe — Dien ” Bythetine erated ehecomncenitaepcke), prope (harsh shoping done Tes deed) ire Ths inked eery cred) hates houhe ‘near eeesson would) taper Choaman. Baer bal. ‘reched cose see preci ‘MARSHLAND NEW TOWN- THE FIRST HUNDRED YEARS reminded Nog Operon thesbopger rete) Redtcom in shetowf osha Cams ad (18) ad every yore ore money (03) alee by oe heathens and bas Ponepined(2}——-—-thewont ONG LIVE MARSHLAN lenge rom rey any poi) sah orn Tin nn beeen, Tere Mis Big becenenay wou predby aad a Rew ech ‘enn che ord genia Spend Siemens 2 Pato nine 2) Jobe achootemskinghim ith namin. MaDe 1 ityondonpey Scie ae 9 igen aren «9 Tihouidelpoemaningmybomense” 0 ikerjneTwccdeeeravemaicisiieiop”REEN 9 Eeyore ray tas erwcapedibejoe””” THOUGHT 1 Thiet praise gepouene ® 1 ityoude dhagejoaminderiliemeigasc” SHOULD 9 foetal da gi RATHER FILLED 1) Youre pen wha — ‘hog done around ere! 1 Thevintiboughtigvecn, Shahar 6) Asleyceddongtelane wash. tnowengngash. 6) bby keduupy we. atoteply oh 1) Upon had shed could he pon 5 ‘hod getbrinine weld’ have made yin, 1 inouidstbenrprieisPsk vin Barbed wate oarboliay wonders 5) Talc yea Soy longer 3) wo beruepd aks eal ond hives evtheeto Stout Unit 14 Modal auxiliaries 1: present and future Explanations 1 Doptbaeiorden oan sbuececblgion eden rete wortsmnes 2 Murer on chiiaionsstodoronehing “uote term bored of etn hee bul ppeanongbtocnsobevse. Tepcwn "fe ond eel 2 Recommendation ‘Think yor eu lh toe eth your pret tnvring alerts cress oven obeaon pli “Seon sent heron 2 Chmofanaon “bl enioncblaee ihe ‘Sol she pgen oyu dee? 5 Shnldand verb inking ‘Soule t wither hinge makesnopinon ses "did html olde el Wh eand ace dibing chance Waloap ted cdr od stomp fey ocd andthe Spon hata coindne Tiegh or ba eying iteseme el _Nberinr toemphaie oka “Tm cingenumivln chad Se Uni wor icondo eee. Coniston pot or ences: “Tend bee ae couse comps stisvoeepntiliy ings The sinwin cide won eld bebe Meson congo tochat nee nan ope scene 4 Cold issedsoespetunwilgnes ‘eo oe Tn robin 1 Convith deze omar Youcenberealy cnn you bro! 2 Carns hbo recap. Winer cm berely el Bape neon Seber ein steyaeoppoice, a Toa beon tp (metic) Thocerbeur te (Pm ant) 1 May canbe weds grt along cles: Shey ees bt tha ner shat Sete, 2 Meyimighar vet Pisce hol hinge toda something hich pene ‘so ena oat ‘Nady ea gig ar ap ne ortbelren sn youmay ells 29 Mayan nigh hese pss onc ey more ‘common informal Thepee cane may find lation there, 4 Tiss imac eprenion when sng mayor reset reenc, sigh frp ee Tipe Emig oda pemy ding ree Aibogh eben pas ig 1 satan wed whl eons mpi soming hich ie peker lesen thappenar wena open Libel maig ye, esha! hats cneed hee) 2 Siu shi wd rales en elon plese peyote ale aerplier ca out Need Rene soot “Tico ea Tater me, 2 Wiuorcan eed empl oe aman ofthe peakers incon tad an scion repaneo euepeon “Tita mone sent Sains ecient it amen rea ee 1 Weald cnr oansnnoyng hati pal of pean "kat in won opie + sategneenprinennn ti ee a ee ay 4 alba er be flowed by ines dba eyo Sopiceae nn THe for nd oman het ald obese seraeiobereeon "necro eae 1 Need icnra mod any sna saceale, asouneedionethe plese? 2 Neda mol any bt msl in qin ad epnefoxms ‘Ned joemake meet? 3 Seen armed ding Thi erect poemtorfaae etersepbonc here 2 Beboundte ‘Thsaer sf rtison cain. Wibowndtoainionares 2 Choosehe mnt ‘sinlewords Snel 2 Pacont ible wodinadk a Rewrieech heen tn, Shemenig eye Activities 4) owt hk you eau apo ye 1) lesson pet lve iho aig 6) Tht mse rel one 1) Therese when cee aa oe ely hey, ) Weasenioyngon boli hog he weed Seber 4 Yee essing hee 1) Yousuliay we aera me burda yee cle, ihn poe youre ihe ii 2) Viale ha abedy sold a pen hat nd of sain 1 Nomenteraftesonciton mul rere ail dome om ‘hee poms who ren ema 1 Quiche, you nigh sgl tbh: 1) fing shoulda Wendy! 1) You "harap more meno 1) Awad no soporte regia on a ©) How tow goings ute We, 1 tay yookietadog you ie £2) Iimnoeaesbot ay splion cacanTeedewo copier hee) Be cry Pathan lech young > ie Uehepace suppose bit dora ee ie 1) Rohibedacsssysaeae bebe tine ee eee ih, 1) Atouphyouseincharg dons ge youths abe de oun ech a dar oud ih be eae 1) Incomes Bapbnforsseck Veet : = © Wanypialaseciolas hon! Since at . 4 Inppne Race aol Nada scence «) Tamashapy poeta 1) Atough eed a cold ibe 1 Truc Peralibeonins 1 Faney son snd tn rsa - Node = - 9 Miser yout dbp Tae secerrencceeas = i) Dovebavewionewcuy> 4 ovasthe Senco, Taos Sacoguaethe 5 Choothe severe » lesehirbeh willbe desened sHouLo Tilbeehibededorned 1 Thc poly Ganges cou ica aig ae cm 9 Youetibonow mye wo Fiotdion giagteetienaeacead”" eoULD 1 Boyowsumnsioransllteoreneraad’™”"""" stouLD video dikinayalichraign wou 1) Fosse dhs CANT 1) Wouslbeatctanevepeopaom saci iy Bin lt igh ler eing stout 1 Wethouldinewatheanmenomoron 1 Hh you thai im now Iaee 1) You ohio nowhere 1) Youd enarettgtineaw rather 1 Younedotcomelyos dr wut A) Yourontconefyoadan weet. 1) Youdon esocomeiyou dn want 4 Daiuiterrongforyoute wake har 1) You donner octobre 1) Youtheaderworksobae Peper sete kes 1 Te ieee 1) Taeemenbrtbe eye 1) Tay hy dregs oetinned iho Een ppoute canned 13 now Wecol poeta ested 1) lived bequterangtorontolok hee inthe 19 We ber nonactectinc efor {Wesabe enthuse torso 1 Hagen ath deionised ewe 1) Faedcsonmptbesonoancednen we. 2) Thedcsonileanmouncednn we 6 Complacenh sabe werdor 7 Rewsieech sevens hat 8 Compl ech ‘sabe werdor 29 Athough harden nee The Toncrssond 1) Ty sslmy. tenner The Toorocege 1) Teyal int mayne ee Te eetns 2) How ony that orld sat 12) Tocheningcomescn arty You. tin, 6) Thepopebre sna Ym Reel Ofesuet tet —— peas dotenyourary 9) het ped eo Hadtornbmet 2 Ofcom weeps none deere = Losec oat adel ‘moe ) Yo a ‘veri ene BS Hila ce 3 Yow cei bee don oper a Sad bead caleba 2) Pmuethat Maron, wu a Pha be Mar —_ 1 J kepegving mp on 0 ieee occa ay 9 Bontbtitifingtome ie 0 Titgleniphconcbadcsodangeiciak case 2 About ions ietempermannclic wees May 1» Yorioalcnetion pal gaia aay 1) Tiisec pola bcloag woutwnT | 9 TsecibcinpocwSiyeweis”""~ possmny i 2) Matsa shite Shall easter seit? twee ©) Tank youtorefeingba pobre, | Hay es abe ta 2 Ok ing cs anche Pps ee eee are 2 Sekecs Hemyaitwongundie nanan Aeylecerstomtay tela Tn A) Gare in wm beg cll wince 5) Nove thas wes Wiest ds beste 1 Rale6.Nomenber.. ‘emer the bar aca wearing pons it Unit 12 Modal auxiliaries 2: past Explanations Aad wiehepalrmelmet and fesonpaselgon ‘So mln hadt pss ltr Reeuiclomdarthec Wee ould ype ont ois pone, 1 Expeaton a Soul bor reasoning chapped bape Thepoel sent yon nasheed ee "Youle entero maha nigh 3 Shoal beef hiking rope ‘Theputnrmboee neh eampeian ale adth sel deb yon fs 4 Vit beandasine desing hae ou Tismamgbat youd eotyig inh mehr 5 Armtncnraiondaoneinastin ato “Teed ashing for yon” Oh yu rely ade ae! Theionsion shale iced mhsenea som 1 Se etn onset feb possi) Ieoldboe beep ones) 2 Conldrtheocs ale poner ethene 5 Caudnbeseem be tradwihcompurtne neces Teco bce en apperoie de Oe ented donee Goede) cot Mey hevesnd mightbave Ma beer oulthne 2aeinede 1 Conk pa prminion eps, ‘When ween ea tye 00 (alee) Mary cond mim cheb are heel ad Tey od hewmen sree (bash) 1 Might pu pony whch no srpen "ax migh ee drone! 2 Mig evesndrmay hao eer oussensin. pone may bee been er ose 5 Bouheabeued nae expres uncer. They mighnet hoe reroll 4 Might bevel eens smnoyueestsoneon fare do ‘onehing Teeisnong ses on te ordsuneried. “Young ee ame my noe sere 5 Irie hee toe oul is unsonty whic herpekeexeee ‘only hanson este some Trigthee brow tha bred eee tire Jad abbas Chmightvetawat 1 Therese ener ceri aout aps acon. “Soneene rhe aera eyed) Yaucent beet (fem eyo did) 2 Bothcanabo brand wihsrdy incre ‘Sandy joven etna! Eneyyoemt hereon? “Throne an snwiligne inthe pa rene onan bec em tide trie lion 1 ocd henner eenin sepa aich dd otal apy “Teed boo acptedb oh bt dina ome hae 2 Ausmptons toute pate cho pomblewitesuive Suon clef ef diese hore heehee Cay probaly 1 Nerd hen do tan enecay aon ih wa ely one Youre hevepiatlercne (Ys dps) 2 Din ned cen tom unncra sion whch net done. a needtge ita dese oy baad conte Ghee teas ‘sbiewerds Coen 2 Complete vouch ‘atlenordor ewe a ews ech ovina, iesigtys the aves el ey boa ayaa oplasse daar inborspreem sn putin old al hve bene mist eden cone ‘Stein mathew fe Yoana ee managed wut me mig ioegoeap ona Activities 2 Th kyon aye meen 2) Lephs ler coeds ee 4) iappove bl condiaelohtla hy 1d eke irate auld eae 9 Wortiows oho ne endear hes {lines joottldhne begs mec 8 [estes lenebthey cn 3 lsnpiypeedarvetcton you 3) Haber kos chats probed 4) Don wrth Crna she mi eee iti 1) Poet Dionysos mone bt ari 13 Totrrary spe! Yous ent treannppondiobeneet oa be ‘D tapewlenckats ech ened goose 1 Tegal nen inne y now Yon sin Wrote haven ane Tectonic ston Theta cee one 3 went Benne stent, )) Soireayaushovcllebefiesmie sok! Keo 2) nwt vey italy mstoiniemetayeurparn! MIGHT mihevetitdme ener 1) Thank youve maori me Rowen! soutow iewolstiavebreiialayoudontbewoie”” COULDNT youre «Taobao yoarkesapind CANT «iy oslo inate psy Complete ome athe ‘dele 5 Prorat serdinech Suc Words wh oun 1 Peps th die aches ws fa acer 1 Theresitaeapecediomaran Ng 19 They cpp we Have 4) Paso menioetowhu Mario uid Heche esau, 1) Fine acing thea jr eta Yor ee 9) Betorwatnopeiemsrt ee cule 2 Tins ck men gern Re cd yon, 0) Thatwartcky ene We ied bane. ices B Teemenisabiburne You nu cahediferolong Lddilyout 1) Thee weepeyatihasshforhecane a 29 Say ethene is meting Thea tely 1) Tishomeworhisnra gods Maho 2 louldhvebcomes silane bt teed ott. ja Theor when dent bosses ay? 3 Poessitcethnsahe.hmebmterreaere ee 2) na hvebngh atc blended olka then 2) Wrovleney 00:0 haegvenme sree 5 Dowtahenra et apa We B Hsbeenmorehan wack! You. hmesame nena 5B Weve gudwhey. We ist anstod yan done thing 3) Youralym—+_-hnegonriosommcnnrne a ‘ov ihughr a severe alo been oyu, 6 cocaine 7 Fannie shetinesh 8 Comptech blower hae ° nando 2) Youm'shae ore sexton rae forge) 1 Pats haven mre fli i ad ed «6 Femcemgh nathan ndestond hyo {tvs ony thse shelve remeber 1) Hany maykae ete mach sb ore ao, 1) Yourosthavealne aul Srey nn 1) Foran ned ae gone tear eon 5 Youu havebensoueind® 1 Neal hve managed nha you 1 thwepoies he want open nould have ees An 2) Someonbsanly mathe pce itp by mike 8 Meco =~ hae olen thing a syonthoasig Stn ie made mcte 3 Yor ‘Shae avespestsomch ony ren ‘aa ‘ovlinlatestsyhng wes 1 Nei lesen sng nord Pun yoveanaeay ber ht a ely Fy iopensciecindonr advo grok 2 tm comes yaur pyar 3 Mow dipout Yoveuld haere =_ pet ica Ambo heeded one Kaowesowr tock poter pos kaow, ‘sed erro heehee a 2) Youshosd ave sen i face He, 1) rman egy ~ 8 Sire 4) Youre 1) Onesie soso 1} Nace cna Yoo athe 1 Rep rouge rome! Te aie wade, ‘apa ondobe alow Ene ieee tsa ‘ —beuhc cay the tm dese! Sealdkaee trae 2 Thepolie raed todo sting tou my wy mghbour 1 Fant feu cvs indo 0 iy dt yon a) Goreoryigsomuck ans waa atime 29 Wauactpiforecaeoen ee 0 Grcglneaow ride Beye where wie. ~ i ere Invionter 1 Wi pou eos panos lnc deck de deo pon 1 Soaloomn ancl aay hal Unit 13 Inversion Explanations ‘Therm natin’ averse dient granmataloprson, P Usngacenan oom themainser ‘tony ee pet cen, at a ate dvd hat be Iebben dig chee Neverbelejeyed mln! 2 Changing rm paiinsafvebandsabe “Angst tetcameasargeprceon seiner megantonsltareampl 1 Thiscaly cre whenthe ave acura einnga case ‘Avteecplsbw ne onlin formal aly bor ‘lecesch sn pe sears Thy sen sainereay ohn Tnnguige Compare "ie bed sweaer ce! These beefs weakest! 2 Tieespesions ner redo ‘Trocaremomcommriy sel wih een eer pp, Grvskmalocbacen ancl Sentra bre sence TRariconeminiter hese ee fed itch pation [dom hea zene woe perforce Ren ed bdsm repol 3 Tine expreios dy bare nem oner Troerdononncrne which qi flows snr Thee Thuy aed i peptone moner cnet “nse Noe wordnet conan ie “ely dt sini ston wen bream xin. ‘Sly bd foe th urbe poe og [Neve bree ot than led ok, Nosomereaitetrm bet ontbepies thas edring 4 Aberonly ‘econ conn wih shrine exesionsoinaly seals sinl iy er pong te edd remember haere ppeeestot erage o en nl a 2 mint ac der wiht hn annie b aah Pare eager tigng “inversion following i. ie “= Lam going bore. So am. Only Mary relied the the door as not locked. 1 don’ like macs, Neither/Nor do 1 5 Phu conning nfnt See Unit for way gvingemphuis withoutiavertng ses. ewer amen tenting nu Simin tod een ites Shea Ne Cette a _— Snteomd oreo cen 1 3 onan eisai rs Neca ae enema Seitemon i) icantcnalrtone saline me ett tte Seer" hark ieccamaeememmidlmeai Som tm Sita” Serna dare Lit shania migintene oa sta ee Ute debe vermis, 1) Only Cuerioead Sly paid hy ssth fl exomon 8 Sincere wee,, 1 Turkana seh mines 2 Qulpwhen Bopha Bacar vb propane ‘wachwiththa emphaisandinmorecomon tin hecrapin ies ee ot 2 Nor edvoppdrneskne mac ‘intngeerasfedie ce, } cee oye rmes 1 tebucivtiemneecanen : iehiadewietnicmteernnge Sich mteoete ped ee a ee > inthe camplesin2menionolostachsihe fu wodia ‘wiubewordor theclause. a phrase. lnget , | Biplane meg SE. egetcrenentecae svt serene Iike wee toccape beech 2 eee eaten cer octiywocipe ec cocina 2 oop fll smeu ove ese {Yih pole hat fonds would hes bein rouble (ae mos people. that would beeing 60 Yoeth plicisbceforndon woud ee ale 2 ferme Seer en {usher pig tare $ret spire eet 9 eater egri reesei Telnet 3 Senbingdiitcatont neato ee Sentient ee | “ Wituthoestenttcnpmentney log 2 gy i hie na net lide on eg ei tec rtonns aces fttticltadiertrntontnton sence ang 6) Thelen seic ns ade pace Sihownsothat On 2 Inveinaeres Wad eae wr waldhappen Sold ave hej eto wie nu acted “a tn a no Pee ae ‘ieattay fae ibn. 2 Phraya pln optical oom Dace wich omens Compl ech seems ‘incor Phew 0) Har broke bilan aire iol, Necony es _ we 9 Theyec do saps dg ade Ue eee ———e ty Mele aii tiny 3) Talos tei ad wee |) the government ie meres rate, they would este lation. 9) Geto honor eight wl etoetone ‘ove Guapo) ty Brana cour Noone a wradoathe 6 Newrreder Sch wnfoneol ect darian Coase = 4) Preach you ony inn order onenon? 4) Fond toed Nerve we 5 Ronan Sen hcoyfd rene re 1 Cabbie teieer ce tiohrete nnd gecing moe 1y Mina poi fier See had webeeinvadced whe pence =o 1) Fred none Under accumsethi cone panied cone i) Clacrcotge Shea so chang your mind eens 2) Sechaba tbef stoned aie nthe plt ha omshean emery ianig Lite shah sing nin seee 1) Nowa ht end Ei my gente pistorn 4) Baty then a onthe ide niche balein Seating 4) Novo ed puer by — _wberetwn 1) Sadomdnencte nano rig hii er 1 Fie ea Titec whe irs oro 3) rly inl ans bane compen. 2 Inoay nnn eavepnsbiy frit — 6 Rewsteeeh eneacesn cai Soar were Coins crate nega che 7 begining ‘Seman 1) WaeSnihsoreignimighemandechneeofging TE Sih [sober ren! Sth resid mi Secale, 1 Sch yaste demand for cheba pope gueed dey GREAT «hematin obeidundrsapdcommances NO Fly ae go shen isin orm” SONATE seared Theale csc anche ed 1F py Uiicidndsicon chats eelifoe” DEA 19 fexsony shed oped bint” DIDT 1) Thescied evecare aiorwha had dene” ATNOTIME iy Basel sein nest cane ainsi” 100 1) Assoona tno bh soneoe nocd ath dot, ‘Novooa bd Tene eth han omen che de, 1 Theremin aria mares email sed Sach = 1) nesconeaor ea besa machin Mar, 1) You ewan earn arbre Conpiaeech denen ‘ie end oe ovale tepy saat bees prerie dy Soh reieerw rove 6 Tein are legac Petoinidy na (0 When hwo ca Soca seneshe _ » Reihcsgjonecindentig paps 9 Thay sacha halen ema pean me, ipa mates Netelre— _ a Tiree Biekde nhieu gn 1 Shogo eed cold oe eae? a ee cos tig ett eee aes ae areal Pentair ins: esas huechandfostin pecs haging word rerocunge Unit 14 Emphasis Explanations Psmeconcins arth wa inmate gen inane puting reenact wha com eS Uc tand “Alva tenure ben eke ee Freningand inion Inversion breresto changing henna werd odrinhe estes thos peonional praises belrethevee Thi snes ping ve edoe chess “eddy dence tera Upintthesr ocbebalo, ‘rong itachi the orf stern ase an pug Fintforemphasachnetit wold nal sorbet "dor tno here the mene af Wher themony seeming fom dn hs Taneprane canary psm nd re herp tine ‘ener npran “hace tck Moe deed phones pale Mayers ‘Thesarpeotmey cancel ahtoug ich canine seh fra apron “Aubughirmay oben itr inposil Digit aiboghtmey seo. ona pai Clee and proche “Tae ateseneneesinved yi we ob acne begining het Dileres palo eencon be empha oy Inspects sod inns ely hepa Se boned my biel mabe toe Suche bree ny ibe ‘aera niga Se bored my ie Ieseimybikethat Sue rood ‘entre on bree atop ere fiat fe Molsvodaersesi pole Yes cathe readin bk ‘eon bes betes bon hao Adding wont locemphse ites Thecwecmonvihvnechasmed wa te ee Wha tera eather Youneed sire Whar nerd ley Iisshoprce copa cei dai Teerfihewadoeroneced Whe Pedi eae in anche Tera arid rset ‘Ghusebegimngl enpe on ng Toler embers, ‘Aivnetinente Three once steve Tieermyesnie 2 Veyantinded Vepenbevsed empha omenezeypec "thes atctmomen hereon Very sind saotheron tna cise, ‘ery 3 Enphaingepnes \jsolenpsng retinas lately ‘osname ‘nical abv Taree bitierete Noardnancan beeps tall whroever Thewoereene para The we ote chateer Thecmenphce warns they sresedia sec “Sun you ate Each Tn argo? 5 Quen won edingin-eer “Theses anil tele eon. 6 ire ‘hiscaenghaineshever licreseinspeh "ett relat showed ple foon debe soso 2 Advbnandascines Sei igetonbe oatmeal ademas “Teulon neon of be Freie iboats mathe bela. “amepesplesre craig puller tna Hegemon met Thee paseo! Toaccnplraeouy pose wihaGcier heh expen abcke Spoon gases) Towable? Thehind eam rion a ite comple inprible Thogus nat rer oe Sorseresinaeomseft! Dovtcock deena moe mth! 1 Eahingprer who Theentpensgeene jhe bot ynareletng for Seis? 1 Timers ‘Communes diy fied cine nde ia bn bsk er nd eee! 2 Repiton mon "ridin eine 1 tnterptionfa phe withapoesincitipoueront efit er menage eaten mange Tetra smcenflmenipe Conpleeech hoot mont spre werd crwerds id Activities 4) Yoveai comin eyourenatek iit 8) “Rantala «Fava tn ech 2 tsb vo “een thatthe ie sei ord eee, ©) Teal eoyinwiners atone “ 1 ech edt ent em 1) iecdeeovnmeat hens satiric et a ') Deehatimichinen vevepwoscaiioes D Cathy wantinthe. pacar when easinteake intake tober wedlig ee ) Han’ stand gering up early, wear 0 Tia ALL Bi wyatt 2 Tey 9 atheros" wyg ita eumck agg vane 9 Raya 20 0 ain yy 0 ibaa " warsoever 2) Dow wor. nea 1) hough hase sured a 2 Mrsadahe crake dwn tremor plane Yous hat 4 Bese wessorouphbacualsenesrcte slr wees 2 WhawsalWheetsreyevleckingstne ie tes - 1 Fwoulletomale italia esha ee pond eds, 4 Eames Sion emchamege 5 Sllewerder eon gen 1) Oniecoure wrasausapslacags yout werk ad 5} Thorne ings bang ase eine inl done 1) aoe hom wig pay forte duane ee ee kage GT aoa. 9 Neca andiheward — 4 lec eps 0 ey igtbaesaneclduine boy Bara emery 1) Nb yas tune sen ago. p Hacwcuilbncareepecediobesln ty Mcp onwdoaday 3) Nannon iy oneal 3 engines bop fete texted teste reer Bueno. ana Be Seemplady chshaaneee” Blaney by Petsosidlnotaceotbes map egy ssclycbgote_t)bypomeass Mae hse theo tig making oe Dit algae aber very 4 Myeushmethan-awaeo tine fibers apaeticy eer obey they aw toc Where yok then? ead de sels iat 1) Hao tein iaoe-— hartge Sant a gable vey ta youths youre dong might Aca fo Mhasoeer 0) Wher 1 Phat pevetolameme orth nlm! ante asingy chery oYrealy 9 Reldoiscr tetas Doe Mey chimgly heen 1) aauucyethe nwa mexpecing baby" Bi a ened Ole 7 Compe eh serbleweror howe 8 Senne erdincpe nbvosurae esting ty the 4) Aloehesnin ereedlyedby log.) 1 esate mach ny gaan imped he, 6 ond st Ts peaing ores reine sayeth {9 ldonind daebetr ccc ne aly 1) Actual yids ute od condom coding ge. 5 Idan fede een parcel aca B lvedeidlsobuysoew nears 1) Tesbook dat ech ne eeyhigt how hot cooking 2 Tefigh il dere baherae wal 1 Aculy wench feed 1) Wheream pongo gee money frm iaether mae 2 Whattrabyaed aspen eugene 5) muse deensncsnzce yobs 4) leweatert0S0 ee fly torte, 8) Whar rly grvon my no epl abo puna the gue © lteatwhentgwatftcpone a et 2) Whatlidintheenl wich lor ape ie 1 IewasSanntotuparrhow tance 2) lewathecse apes inemien at othe 10) Wht lie mest song wath rome 2) Thom yo by bd hin yon cod hee bpd eich Shedearaing| 1) Bby oe ceintthe pie willed ©) You hae orm youl bate ne ai pr own a feldyen eae 2) Yonder cme iteredn ny pres 5 Segre nn seckaiealy ger banc P Intend warn claps Beall bs Chere 2 Pasing oa alley oun apo ie ake ‘nha uso hei Gemay i momen spnaboutelking pa bueyou 2) You deeming wa eon war Thandie rer, . 1) These odo ned baer. own 0 Tiestdn vasced ca onecr waver carn, SHEER «a Tikeskecc tela wher oF oemeowaaie dancing bate 1 edatigbin for day pics tn Wiiraocab cyan deg hee rie 1) capone orga Unit 4 Emphas Aue qu Unit 15 Progress Test (Units 11, 12, 13, 14) 1 Same reoleanns hae gr adie you bt ony ert ee Yas Pause Wnncnshuedimeuon type ctosoncher eg ions ene TE Go hen shetha eerelge Byaee Oe oe ie hema ico (A) beat headset cic a Tete ey weewrand tone gusty Yooh haneb es alent ey! tinghin how mesh) TO) ea ined forgo Fano) i You ame aginhow Mele Ache eee, ‘came eihjobndl (i). ee haveeneduppon Ba derscom agent evreneche)-saeenc oad 0 ee 2 4) Deyo tik had cashed Complcccch —B) anche weencnsmaneee be sense wihowe 6) Singeain nom Theor de at ‘tae wend — sd methane woke pai rae Dae ae 2 socal oedisnew mate BP Youroru~bnjnebmotie: Peele met yo 1) Ate endel emt mens he ede 9 oes didvelnow what wastrel 3) Yookoow ter hens telat dan ete walkin 3 1) 1g myth Least Pacriecek| eee seenerotah ©) Younnoiwlencichoialedayacanany | NO sedinapish, 0 iwcdkedriculn onda Rtas Micur a = Imeningrayche @) Themes sas eal oh can © iti you wl compile o 2 Wer wonb sje eee 1 Trewedapuiclilocbelacanned py teukemy crite page elighe quire 1 Legh fim wile teas Ferm Seane Tedayirvantoncauy forlorn cami Layee tod jin Intend adage esiagye Wht nnn ici 1) hem Say whol pork tara ergo ys Neva! - 1 Teper ae iy cco gic i Hype aeise ighrok padopinw er Sl. a 1) Wydda yovcinc youve Yor 5 sy read ch godly Toenciotaa 1 Tlecsplcnoncineia oom Se Soomaali ce SES ailing doa chest sana hdd yy lt gs acy had wok (9 heconpany spa tan albonwokingibrfor son Vine nie Sethe eae ro yielded bein fies iy 6 Rewrite ech stn deontconan Sree Srtedeined Mietde Sipemay be 1) Tei one 1 ibe povenme indie erie bord by Giga Marino ge promoted |) Gon hore ese clin vac lesion, 1 Tai nyone wider ihyou 2) Dass The yoy begat Samu aihaldat "eo pean 19 Novoner baer” tn bg pouing dont Bin hen esa 0 Rit eooonctomemonans wet ews happenin. Sasie amg Gee aybmtey (9 Toppa eal meng elect Ma Sead Senay Sh Tread goin nine take ape! Be oe apie apore 1 Soy tmtantnt liar spr then Soete Sm“Ghahe opames 1) Yon noo hecadmeth mys sph nec ew a Iyitepioetg nator, 8 Nee Sasi eed ha 9 Rnendleneeabes wee hse Dy ce Sty ape a Conpaecch Semscewths SSihewordee 9 coe towns 10 Chane esing aor Toredonene 1) Tete be amet Mage Hargreve New Wowie chile 9 mec 4) uct em yo book hi etn! Yor nne—— ited 1) Ldonvtaon ho ptooed bt mrp — ee si 9 Seep nnn Hg vane O Nee ee roe tring int lesa you ceed thee er 1 Usp lining sn you lv arnge dat phoned me 9 Tyner tetany 1) Tesined every day om ry holiday in Fant, nnn tierra serait i) Wel toap ce fod waa 1) natn for youro marzo. 1) Patonaiteds window ol danagelteentoa Noten om «0 lremenbucibadfongosentoboy ny ear vebome. ony 1 pbbcaiion sara ong ave ie Mawes, Sek 1 Wein ac kow is theson tale 9 lenalavcakctaapson dimweyon ‘i Bylaw llrearsent passengers are obliged vo wen sx-bels. Byteie 1 tipo nde arene ebony Marjan en i) Wvimpubearwcoayedateeebor ince |p fsexneonc ad ealed he ire brigade oomediely te raged igh have eee — 2) Mens veleme noo! [D Tthhetad lee nos 3 Tmamaue tera, 1 Maggies beri Foe cveroen ‘theese a ere Rewtcexh semen ‘oni sedis, Shodan ‘mening eaythe 2 Compe ck seileword © You bean 2) sere yoo king 5) Youaremppsetio mth peopel Mhoddthewlrelrens 4 Prope think tas tn or metodo thi 2 Thnk ewondberpediee Unit 16 Indirect speech and reporting 0 Yauawat ise Beem a Explanations es robles “This wiasome tach reso frming inde speechare 2) Tse thu Cy isa se match, BouND 8 1 lle ihimod cis cee erat ates onn SSS enema won - colo mdm Sorcha as “=F migh be late Shai ht) height bate - sil Ren al on arma all =I should love ro come. She said (tbat) she would love to come. vse ohg soup Seite nit a maataersenci eatin nian fcr” SURELY re ~ 2 tnleepenhvihenoine \ Kessepliddjooobingesdala’™ sHovtpnet ‘ip onr ergo cee iaieedeae occ ce mc 1 Dayoan csbaF soup adie teh ran oa me _——_— reanliee ein angetme et 1 The ning bends may 1eizonata pun tre s a Sfearicbeneey Uitte hitch ht doable 2) Jem onan badd int Denk 1 motte impel techy Ot wate pce A cece ree inh d ihe filatad spaced bac fed 3 Tematiaietcaee te vppalh eivenchonn son cng 9 Repel ylae Semper Aan 1 Thoreaurimis---petoberen nttown, » Pec pared withvatolthnkng chaste epoca B Riba compen Stara caitedenaenenctbew 2 Hedy edt ene ging apt ame 1 Aber wchadbenonthebechlvsoloun cee ete, ‘oe eves wih hime paper | Wincor treet pat ioplenlingne be sgorcet wens scl Advanced Language Practice Repoigvels Therese sumer eon eb whichepnthe wordt oer out en sdsar toh Only acon gen he Oat sage itched in theses Onlythe ms llegar ier it sdvatetouesdetanay chet onhow rigor este te SeeUsis 9,21 2 forpepsons og lomtllowng es 1 Vor folowedby ha cle (with can below by pen) ee nti fed pede 3a, see ee ‘rome iy! ie elon apse cree ily ten emarh te pre eg me ey ey ‘orp plan 2 Vebfalowedy pene te ‘tote fod tie" permade ll inet ot mead oon 2 ers faowel by nbjunine osu Monel basen tab doth the was, ‘Arthorseconsn cst batsmen eld tomecing ald Gniow en oct Senne el nt a hissed fromtbebaeelberah(eehewhodpean?) Tepes somal aggre ste tocando omen) ‘reso dooming ft cane won sald) Simeone doroting ‘xt aocon oman fog omehig) ‘nfo bronco odode) ‘por dogo) ‘ommend longo) ‘ue tise adem) teen ars iool) salortoneasendosomeng 4 es wich canbe fone that + dasecontiing oad Aline ets eportoutemert cong Thence Uni 16 Indie speech and reporting

“gin wel eb en ene = em wedinac eee Sdn 3 Iemethespece Unit 20 Progress Test (Units 16, 17, 18, 19) =. ] = Tenow emilee) matpesig rb igang] BER onetietget career eet eaten ray me Zeauieroec eames | Tracer gem ters Ser tana germ a emer ae a Siocecine, eens oe Strainers | i ite intent oii ener eR to iemtarammensgg tee | See een muintameencae rane : eee | ee 3 eternity — fae Sean neymnie | 2) Weave gran wpasayouilbta mbes wshour 1 Menertl mens Pie Merten bench 1) Tathecoenhovc my bug Whee dt. togrthome nd oad 5 hayathewuabewibnctosangetpe top Senses, 3 yen yen oi ery i They mh 1) Dogon” pingantorpetner on™ 1) That ne tind gta nn hrf, 8) tea eamtancesl way eh ehace 6 Valietobuy™ pana beer go = money inde 1 Coullyougheme ‘abba poeta ncn ice ‘ett Ho Gaol Dover inne yaad hwoaingaak apap rica me reine —_ dar rene mse mei ad 3 Denne bain a ee at waded 1 games tach ih- beam enc Dowson ou) ena pectin oct nae ieeoketevaee 9 footer a fel tye aa Yoon " 9 Jrecden ooo Peco al Prep llyoone 2° Vedyeutton fc — tp Snkigiaraenbo ‘owe _ sy Henyncnan hymn 9) ABE sian concoct arc dy Ca cere, Mike aid Rath, 2 yi remem ote Seeger Beka Siete Divide” cup oa 0 nee chen en enced enya oor a Gack akon oracle 1 eee Be atihecer hele serched SHURE pine “Settee el shlong by ‘Oui tae npn ony 3 Face awe was oot 1) Seaheenged ping ing aa nae toe i) Mes30, they eels spuntehone D iNdecme Wheto ctindime ahh Compleat serene icon or thse goings shown hat ‘hemwanngyt 9) Accoingtoreer the resem tinpoorketh. REPORTED. 1 jl ihe cbecacligrcopeaks ENABLED Sepik acho whic 0 Wied wig iotap alos” stout BECOMING. MANAGED |) Dont nderay creo ‘WHATEVER 1 Wi pines ow toa THERE 2 Eye sete gowns dab a aipecdttineiek ¢) Wyola mang vy eens 3 Rev Sites hae Bemrstaaadwoa 2 Moka ingle ony 5 tneyastnpn caine Blotter aero nel pic lakdnibhonccod baleeceeal ae 2 bniccmapces one geal ia 3 Dayenn epee *) Niele onreiing shad ae mine ehing ene 1) theatre 1 "No ijn has pete make hivowe ed” Hismedere a 8 coding Vie ssn i ecm ner eee ©) dons Lnow chara brah a ave been eo ° Rewriter rence ‘Staite ending, Taochae resigaethe 10 Prone worn 1) idtuerhenensorae? ean eb 1B Decsparking here cost anything? ~ Doren a 1) Mou popieare onlay carne ya 1) Pavorgingiotalyoospin te 1) hewn ‘Thole 1) When didyooeaves baie? THE by Tiepaice sie ised stsdpntbebeatelihece” MADE ito joo sehiors bares MANAGED jensen permioionbyhrbarotakesdayll’” AGREED o leenieiteciyoceanewion mine 0 ‘ihoh clair back shecaidavind” LOOKING iz Ho 1 hisbioa wie ovalainione 1y hehehe ssh Soidapl om anime” THREATENED 1 Vii peti joobael Es 1) idesmanagaiebacacen bees or 1 Gandyou dose ashinguplor net Laer now ©) Therensrcthingmore Sead {9 isrcommendedtaaliagange bears peso $9) lester poate? 1 Hawn heughcd ph eryone ou aging. shamans epic cold benim the operon lt 1 Chuesnnocheindafpenon mold epg 1 Iwedoat oershe pene lng herr 3) Wedider—"seihedscerabewar ore! a 2) Between oneanthe fr aati Rewiceh Mtn am 7 seme W Mhthoqeacinsbal arbre Simin wheat Senet 0) Tene onpecelaitio Semengss eerie seine" Mtnow shod wings Ba doy wat oo Try ow agi Noles ——— 1) Pech ah Peete 1 Nelle ia 10 Morel igi cng veri ben Niglncomteed en 9 Imeem chido Nabe nn te a i) They ale Gaon akg www 2 2 Aro enting ort oti eat Semple} tactiery ane otto so) eatpeefcompuc Stublewerdar &) Fwodtenuryyesteilyou wer Pie ) Aly ary wees eo 1 Tent oazedthn Chote hed sgens 1 Stein waited op stack at 2) nnn ihe atthe sy aabon toe pose ‘Gouin bended err aces 2 ay tle ny dew iow how Ait efi, ) Boyer ifthe ceicheer ore wee? ebealowed alto fe etafaowed wo Vetallowed ty Unit 21 Verbs followed by prepositions Explanations scone ining sel ome Moy ‘nuit foueronasecon a ven orm Ma a titolo agora ee Unis 1) Sine nana Seah Uis 2425, sorbed srcig oily sbrbedin er wre bok) Simone oeting plinesoncessameng ‘Teron someting seaming oeieomeking Meedisometing cussing ao oe rocrne (nbc etmeeoit fh) Sentient fososeine hercnira Beretta omega fo) ce eet ieg teed Fensformmng nicer) ‘SSaekconchee rtp Jolevoncnctocting cesomesee foe eertanmcon fone ‘enindcmecnea amen UMpersomeonefonebing qui someone ot someting BEemeing wb soceone Ca gop psn Theron ws ceed eis Shes someon Sepang ‘srr whiny sine mcr wh confront someone with something J ‘foc iometontiog et osteo. Seribsonc tape bed ce snes eon erent pet pve ati) met wi tenting peal met ith en aiden) Fu sh omeig ply ep) Patent ca a ‘pocorn ming percub ra =a ptt rage Sate testa Sere. eae fer from soothing ™ ‘feeicowhngrom abe hg ditinui bm eing) ‘ractoneee fon mre rman oc anfom seeing ‘fe rm sare ‘re ola fin nce aguge Vetslotowed duu somehngortmeing te ome ometing or on ere enhigan ring panie ceed) ‘Suna song eemiog ‘Snyatnlesonon on ont deodrontonehng ‘ipendon someting tone ensametng ton soehng homeo dig wthing rds ming Yet folowed inure somehingapinomeng bretcinn —jrmmccgein ect Ve flned yon we etal tye 1 Chosen tle wd 21 Vrslowed by pepe vechatonetiog tncmed abr meting (be woreda) Jocabon soning se Pocsanating et ecnet sting Something ‘mevetetometing nse somehing pclae dcr) relia soocee eg ieepea me idee) he sory easel onc She plied bel her ads) ‘pb iamebing There dor sppyigen) Stender “nba somatingrvemesne ‘nmi onal semesing opel eine become) ‘sefuoronchig rteonale something Prferoningr str hing stoning ‘fete somching (Th manberefonshe ne pe) ‘eferorneneosoncone(Thedaca ered meses) Derapredtoseting _eeosoncing ening mate etisdne) {abe meena romehing eel bd Senet Seigroehing Activities, 2) cond ith ia eran 1) Mebsievetiour rade propre rhea geen es 6) Teepotceidto tame he sen ant alert, The Mine resgned ahasae sone. base cae he chen. *) Caen sting a core ego ah ekg te are 1) They ewe ce lh eng egal aoe 1) Seems hoe enue fate doo red bbai Avene Langage aie 1) Tesi had bee jee ihe vic pone ach 5 8) Thebsroleddonne opened en Compe i) Exehing now eens inn ie wee tere orig Seuncesone 2 2 eller shannon ssn a Conpacendh i) Thsyrscolocne conse sree oer ser comeons, Gee Smencvihew © lepoicetanmy tie tas se Theale ems egpcometick lao Prenton 9) Whestwdjem boa irdance lope, 1 Beingichdoomtcons = mathonadeersied B Ine JelocgeRe min oe sa en 5) eartandibewaysssentoting here ene 9 My paar aenrconngtos he 1 Codyouplaerdnin inking cic a 3 2) Tide of marine dope uonewordia §) Wen nfnhiog lett econ eng (ether Echo) Howeporlwatloueld nats toeng Seedtalome! Hovey then pio jor ein? Brebliaiihe 9 Hecwleuvho hewn wibtecnene iSimingeiie” 1D Younes" yous = 1 Aine“ kinietis ae 5 te fom dangy why hems 2 toon cee 3 nro heer 6 4 2) Persson ewe. 1" Satss Revie” rae - — ements) Acero bse ew oe on seplineiak, 9 danadaad lemme TENE 0 Hacc aoe To eines Teceeresiclpemiccniobas wer o Youwatinwy dost ~ aBour 9 Binywaiedaiacietaiotlbehie” rom | 10 FevremobeFenconpach rom | 9 Cisnsind ne etapa ay il wT | fire caddy | LU Vera filleed by pepo 4) Dine packs me cammed th emp hai wang. 1 feces iene emake Whale dew myc omproingy ‘nto vette “ean osc bale uningwiegrine biel n-th! chad ida 1) Timwareenpe. 1) Misys 1B Taconeptte 2) Telvine Minne reed ocbore 1) Yeataiharsepingsesion apy vet 5 Oniotinereynerie Tame der mln Semple 1) oil eerie. Jal igtecapi ? Rcd jcaed lapel reinded 1) How di Shea,0 otenews ar soad? Deis uower leon appa co Sanwonehas buen withthe ech be Soweing sig chomping) ching 4 Dont wens sbou tcl Lt meceed sane cdevone Dee 1 Morethanrwobunde ple fcc inven, aborted Mengoed clopecined ovals 1) Mewoobiewihoniniwedet=-withapont Robiened shed lmghed odo 1p Tp pared a hee ah mes Bcguined Weamplad eed Bim by Pattenden oor anh ‘Deonpnled sie ceed ohconcnred 1) Tamale tho plans tennant deomgbed Noid Obed ole 2 eee amd dingo Dldrpened 7 Rewsierch eres hac otic verdana, Indvate 8 Complecach senreethene 2) Iwihyou'd Secireiae 9 teigfowdogaaoae ea! 4) Your plan doesn’t allow. oa Fecciennt lat 8 Reval mavted— “Ne Textarea 2 ei D Iheoppayeecee conden 4) When eho ies Toy psc fed 3) Coleg stapes mesic Prepon ‘being ses rig abot pice el hei tit prabem Fn any arpa tehowe tangs weties yourwemens heal i igs nd ingoving repsiont (sowing ene Unit 22 Prepositions following adjectives, and in prepositional phrases Explanations “Tisaniclocaeron asin of expen Se Vol Unis oro estnehiares Note shere ay Bete: onl meng forsee we Geren, th dire pepo 1 OF fio eheme nde. fl Beealefoameane eof epee fe 2 Abou anetged sb ceo! abn cern abou ered chute ht iat son boa sabe wrong abone 4 Wik ang epennh emnyed th apron bored th, “onmnratth ooneced wth bod dag with py ih Inconps Hest obened eh plead wth prope oak operon annoyed penn bade be oda 5 On tenon 16 To, ddd aerate ind, me, ‘bf lie tf fom) mead proeie 7 8) bf bred, detained dren by laud ced piel 1 For ear eile fame te for befor gly vpn ‘ly fosrpebefn tory for 9 tn deft experienced in implied inte in 10 From abetiom dervedram diet fom fram, ming ram 1 On exauborig (exper banen comment on fete, ifn 2 To vent analematosn anand encnoton ntl 3 Over beinatoriy oer ee conan ben dpa ove em 4h ont th ein dpe icc ene with nk guemith eonip ath 5 For admoatn for ono fer wef, psn perenne rfodirezrtf nfo ay Sporn wih ‘ntieword rnd 1 inadeane inthe bane, ial ibn inane nan ee hepatic clinton cmp ‘nari dene demand i pen ma cere in ‘cre m bend noes ofc ees frets othe shrnny hab ‘wtb hey in bien en ean Wi wiibeeraponof eb inert wth rgedi ithe iw Ae errata ited atepatbend, 4 On oneoruteonapprona one pl bation eal onthe ‘srraren gn tm non nna) ome eronpupsetiecres} Beyond yond el ond kbd eho of doa By. yeaa by mia yeti by igh bye fee african mel to Somutinforirmrbog mule Meso de dered camatande ca nec andes teinpeson tt nde tere aro) st ‘hgaton endpaper son onde pie “Who ethene chan wise dln ton eon wibeateerd ‘Win within thelo hina 1 Aber feral Activities +) Dinneshoved comple dine fuer ow ley 8 Iso ately Tins acne 9 Feta nfs aie 1) Tey mon etme ince pb cae es oe deg. ®) Ourhowe bes bein bmi ont, 1) Yoorepeetycpslelatafmakngyorownbelmuldhrethought! 2 Seeulledon orl fling darn 5) Thsioneof teen alts hele 1 Tumse a opting oul esha. 1 Memes become am comer 2 der vondin piano Siecening a aon wile chose 4 Rewsteech shen sat Una 22 Prepositions fotiens vavonel pros, 2 Meanie ong betsy ean en oy Yoerey ne etlonjermr”” ADVANCE 2) Wegetanvery well thou newt door reighbowrs TERMS 4) Everybody wants Pauline asan sherdinner speaker. DEMAND 0 Talay ete weginaesnen MISTAKE 1) Thewhaie eam wan ina happy mood. o soaners. icing ong conscious our 4 Youcan gerto the wilagein winter Becawealthesnow ACCESS. 1) Hen ad retain rhe itory ahr 1 mal every pod onal 1 Telovcarie teppei soge, 1) ten themprein t o icd Ina on 1) Temi ated ht ate then ced 1) Tatras lmones ns ndsvsen cope 1) Yurpromanc hem coe fvee an te 5 Nowy youne pepe cmc adSard drgvouph ignore 3) Apresniyshonter fui les seciplaud tees 1 Cloldnesvbvesvery god esenp-—- or mater 1) Aberin evi, Lambros when ied eid Ge, IRentoklic carded ate 1 Toemering i poy beara ) Contin you poison oer pcg Une 2 Emly on ssiblewardor hee 6 Sa ett imine the (0 Then etsngempoalyinacarean Foch 1 ined aocoraa 0 Tews coaedechdee ok nner reine 9 Sg frny cogs olen 9 Thayer lade 1 Beyond Fo With, _ ae 1) teva very pod... yoato help Dare withis homework ‘fe ae 2 UW Reting teeny ectipethae 2 ‘hom Nema sii Then arhemongememaln oer ee ad ‘synnane "| Saicecelibonien’D)depse 1 Aercuing peur waqunes ne ee pt om oa send © Talitha icant yore Sgeelaiske Diet, Sieeanen ola re o——tcbigaanchetegads shh epechedbere ee ege Demo beara shie atin ae ver a iBtootemphienran 2, ME a "he ation ewe i) Tetansaboiy—Byeaieatcnce ‘ter Sui ohn D Irn Mane abso awn Ainchiae ender Contes Ondine 2) i hid coer ace es enw {tht ordered fn ae ek wwe © likens lain here ‘Doors ik you ei yu ya gi EARNEST oa web mang ah geigloa VIEW 0) Betws onayany eid JOKE 8 Pato wordia sacha Ech Medipacale Prelate Thebepng et in Monon floc adeconans 1 Wonca wharhrbodtowrsilbeplen. BALANCE Cp 1D nihtheeraharedoabourhspabim SOLUTION 19 Vout alee aioe aly fomibebnde” "wore 9) Raced eilorersnie ~ Recocnmion in Youkstopyyorsonbdobuanicnonerag ABLE 1) eed wrt book in itn withthe ois college 8) Mary sen tera : So 9 Taso ‘iene home stuck aca {) Ganbsseicacojousn —lorlureenssyretoe pyrene 1) HokSiy aogier fina 2) Morel thoephoterelle heart = Thee By Wahine yosvony 2) Tew ascot ou did on “ whee eciarta icc iong wy rod orothecargarmstenpt you? B TReconpeny elAmte verkforibenmsoreo—— ba 2) Thepolequeiond ethene 1) Some seiner for choca 1) NownepreTom-—forhindocvey {Theft motile sere py beyond he 4 dot 1) Ean shold beige onion bere we decide 8 Thepopanmatengstownsginin =e pbc eer th aca 1) reganewaraigneds pring ce. Eiadeneens neat 3 Whois fein tc order 3} Whensene mona wemmining cogent bank ode. Unit 23 Phrasal verbs 1 Explanations This uni an Ui 24and25 mesa widen al verb nd sheirganmaiel yer uesrny Lnoen Thence ‘rani doth meigt known hal rb Neth ey ‘herman fr dev teh ‘ddan ‘ite adap ‘Aster ec ieee pn 1lklwn een Sierourgb deck dow supine Wht hope err bo omech fic emilee Bear out (confirms the uth) ne Tidal Bea vation es) ‘ela doead em Chr hdres seat “Mebane hephne reaketconemned “hep opto sing ices Teen orbit by Bendigo Angeline ndoromeiog patente fa bo Sinn aero eman ‘costcokyrthenn ‘erher beeing cat Beng ron icemerren ‘ered gh canadensis Benge one Tell ging sperma mate alert cay tink rd esr bate copoly “ploy dois len) ‘chap any ano cirecmpee i Ton Cecio 23 Pil be Catan cones inn cc content Tl rine continence) Tekan eee roe epee Lime, conta eee otiec Tet iat ei meee concent Te aa eee at cone ‘apanene topeubaneeneaeyrk com gsr ah Tal bg hpd contpagents stil) cuttin compet opi op Trin Slt clap conn kei ne Tieton opoabe rina pion count aise copeppcpcty-cle ‘pe ated pen. onc he ‘ghee dn yt ra Sina ty wi met neon ct Feta exp Dawg “recep eo biccola snc Despapy seco ae yt tay get de li ay anger ep tone curio de with epecil repouiti Torhaeo fret youroposee Fsbou how smesenat- cps epi -clloi 1 ‘Ever el ea he Jnl Goteont alleen acoso) Scere “ibe mortcmerotran, oe eterno acon = nr cic ‘hewn ero. (into coat clegsa ‘ryt ene eo raledtgenlo) ary Ser ot bo ‘iltoepfatoco weg) "epee 2 Fedoptotedepaltean) — lS feos ia ny Soca Folavoy teense ae ‘Taner fons hk oloviews Stinor, (Gheporscny Tete eifaloeap ln ee Secs aterm ered cpa pendenaro) = Thetfecng ping roe ata poat ca) hrwrongeg cach? ‘ident cog) Tiller gender Ga downo begin ei Se wi) “itimee get der onl Galea avidpensbmen), They we lc togetof ab chlghsmens Gexonlrapponsengecnelnne) “emt begetingonfrevey Geon(mike progres cpl ie) “See geting sry olin hen oh nove fr cupid) "enn gen hw wl oked Gaorer wi coe oihend of someig aly spe) “Tlegedspachseofl beeen oth ‘Seoundtintineofe-cho rund) Som. ba heer sro fc a 9 (exept Go someting aly nd hen shea cien calle) i Th crema gring posting ie fren Wachee you ben geting spa Activities 2) Faces copie oo reser alps 2 Bilethaedipeagemyenll ce atu 5 Sst pcan ret 3} MOS detain anoct een 1) daesitink hisecod wi eee poplar cares, eethik bread erer tbo 1) Apoleecrasjus ppd oni, wu Ty i phan a ee cor 2) What youryingtosy? 0) Gan sappeaogeo dle on 1 ively besoin a w 1 Jenison gooae io 1 Youn oaSeaforely count » Wiaonslprogerucyoocalinginyourncep GETTING ») Revmcioaaa iadiowtinioneindeesd UP Adeanced Language Price Prone mite erin 4 ‘ean ‘how hat ee 5 Resticen Sexton Satie esate 1) When greases peinbe ei ot 1 Gecingupsocsiy rely perme 6) wart podidebe ad dda ol 4) imal bat our sry daly op. 1) Isso surpid hen ey prec cs 1 enyrnewbook nnn auren we 1 Samtone wa nv aeryou the yey. [i Jatast wren —allhereweahooe te doe 3) Netwatocenburaedtona--yptequrivn fbo would poy 1} Thepaleeddae op lvconpansaoa schon 2 phemgratana a te epee 1 Bend Joan gen ier oder might ny ore 6 aa cea i - a » maaan ote a ona a Thrtenrhoncosherielbyhe = 1) Tete atc over, Tele es brio seek 1 Carol tasoablcommorcning eriestethes, 0 Wharippent ciel ewe pclicion” BORNE cer 1 Fi otc oa FOR ») Beroayenareceingontbeageenctstmanaat, UP 2) Teemesing ie 2s Dada yeicap ceomestoot oi atlourh ly Intec! gueion eins iMpesmunate Haldispiw. lleckupte—_Djeomendownie ey Meher denny exten Heaney Deupte cleomedownte s)gedownte «4 hind wa igh bt ceegene Siuckdocn Nislowep eldopatl olivaky 9 Wacogaod pening poetry Iltginier Ncemeup ages ScapraO)etdowne 1) Wrereyourn ‘coming pv Nbengngsout Hgeingepo Deng rondo 1) Yusbolscenys aes shea. Nisin aaksker ehedupio_fbcken 1) honey thao reerttothe nes rcs Walleloeop athelaterne. Cheb ser eaedupre 1) Theschon xin even year ann me ao. Nilowetig” sNdeenvp elewedoue Done soay ch 5) When ok erhebusines poten hn Dileleker Wbupintier deny Bleaneinlor Unit 24 Phrasal Verbs 2 Explanations Peetatoattndnesade Team eta Seoece ee eee ‘hatha bose ening ocean fap pn aa oti rate sa ogee a oceanic a {top ~ colloquial) = Bet rman ops ree Spier bederien) be pr ee ee oncaaes eater Se tei ogee ores | gel sierra omnia ce ntenerme a ay, Grow on (become more liked ~ colloquial) Vion me peice Ae mre My teacher bas (et) iti for me ao nce igi ee “pmap wi ep orewbicbur mtb td aditou wit be atone eves ‘Wontbeeyou Yorba meon ithelguencc whe ealogea) “nid ec cay ttf ee upto one by heen odes) obtpn ete gion elsca(lers opel “te do blanc pe tte pri wif Haldeptctoy Sond ine, dap bee ‘crmnenop ieee ei) Jadarsenthllsp won copliome allege ash sia) Taobao devo ig fore Recpeptenie) Wil bn Rpapte gmk cert Laydovtse serpy iy dn see) "comp lad doen arab bind sntion Lndovethypeauties pono Srl dean bt gyn fod. Latncnlc whey) Wehner Tron tbeplonye Lutti(ncuc romper) ‘ete nef efine v eepomings super ab doen cnt agen "[ipine tne bee doom tips son ply qrtted epoca, Lestine ares) ‘Thelema note aber Leche) loth tomo rele. Loaksemeneep thc) pongo trong Aten ek mea alice) Teper mae fore paring. telah th Tithe made offset nace Mate cutorend. inden hat be adn ote Nemo ie (mamgeoseorundentnd) Teun utemabot ate oie id Makcroncoe ot fndemand eon ei) "Jenteal Te madera ake me “ik you medeap th when! Matewplorcompenele) ‘Owr mes mae poral bard mes Mootle) Youheo mint eed bee, (oweshacecelloiah Be pepleg ponte bt miedo een. Owmep cnet) "None be chided owe po breting the wind PackinGwopanacineyalegsi) “eb pecedin biol Paybucktekereegeologs) "he pd hn acral ne, Pekaptimprore-cloged Ti etree pking ‘income dow lnc seer tee) ae imto meme ted bt Ilr pin doom Mayap hee orn) hear ploigapepin Io ar neat rmseenonost) pane ot tha won maida omen Pallt(naogetece) Tee pln ot pale of ‘achan cont vce o-oo) “Lets pbon nd erehtb ong Paterno) ‘Hany lee bt cont isi er. atdownio(elanthecusel ‘Dae! oer pormeer spt dn ener Paint py fora). ‘Seebupateforstntngjoh Paton ot (ake veer ereone ‘Aen da'perprontmaty mel Arends wilde, Puff Gieorge ope Thecrowd pt begmatofend be fol. Pacer teem ‘Weapon ap free diys Pup elem be Tat ppl eit hoster ‘ations Sei i ch onthe ocr 3 aowe sine Activities 2 nd hg tne 3c eect emetic 2 Ml del kate to 93 teehee yee 2 en yey tater heen 2 Rae Sater tacac eens ssp be odo Ee eee 2 Soiceacopsedendannlat nee meen 3) Sea SRS esac 2 Gary hapten reser eye Rcjeeelinealseere ty Serco Sparn erp Sued Tamaki {atelier opener 1 Yowean yw 6) Teac onda auc Sieur a pp frdnr talon Scone = 1p Ineptus paleo “eflincaker pte i) Wetnay ini ow areca ieee ee i) Hrs orrokeicebiwoeporone Behar 2) Wet wach aplogsomei teen tlains e UiStanigebg ce Deca) desir merrier Bheronaaimbunowthyee op See Stealing ccc aicygeenmay theme, 2 omen tr hag inbrnonpiah B Mecahtdlecnugeplnste nr 2 Waadoannsoceapicat eet Londen. 3) Mianlonetac heroin aetine Adoaned Lang 4 Rene seneaceothatt conta the Serdin capil Sedaris ‘eninge s Complacenh serene ih ibe nor Phree 2) Youhavebroen your vor one, a wm 1 eons dis ee PN © Tiny apc sa ™ 1) Tiel antsrpsalarwccpecds uve rome baibarddow ap ur on 4) lhe end we hip 1) Helen anges ey acento © TheFovegn ear aslocked the ine Mie May pinot mich ve heute «) Topeak wi 1 why ont yee 1) Ourinine tray. othepaben by hance, lke weekend we ead wot ioe belly ying item we ined hel DN en 2 Dont Drei Wesel ap 1 Shirkey never. fi Ter unyone Sheil cls 6 Sertewch Tenet sedis ames Stmmnaionitexiudetionmmgi, FULED 1 tntheend un dean enthlee _ one Boca diny lone wyboas” OUT etna eeyone) ©o fo Fineyoudediel corte posercompeitea? GO 9 Basser weston. —— on 9 TietndlcRdiaippelmecsing vein. PUT 19 Hieagrean oleae” MAKE 1 seer pan wiles uve i Rania oeahcpeoplcwbolnowibesres ON Unit 25 Phrasal Verbs 3 Explanations “Tint and Uni 24nd sesh wide rang fpr vend the garmaieypenaresinadyLnown, The nln oni ‘anna seraine nays expen esos ules Noe ‘teem bectermenins torches haces ipl charge too mach= cto) pa he apne “Seb cy rnin down bs (Gesepowe lows ce) {th bate ran ng doom Runino (mee ‘Gneebo an int ethe permek onto (hvecouph nosy “dant econo ide i geae egos) Truman theyre re Rone abil balp loge whoa eying) Tnaeape agence bor Ronup apn eco tlyepaion) "Webern ap gent ssi pele, Seesoomin al tetion spor toy Eodbyerosomeate) Tent ibe sein nieterf ‘Seeough esa uso) “ane trugh mein roe. Scab (naketoncloy ming “Teeitaleesiending pte Preheat Seisbo (wk) Rem abat going ee Sern est ef-cecly tente) either nore dey Senigieindlinsg) Thtdcmenat tale Union emende (eran) Tes ot herent at Gananicson)| teat inert bogepy bt bcamea noe seuptenti)| Aesth side: bas ent saponin ‘cep bape tse sebagai in Suen hdd sigepechesene eget che peony pon wot sor Gade soo) ‘et ryan sendy Qspnenopreen “eloped by iin one suas) pel enepirta ati ‘mo (fel andr hindof eer myn! sondnfretepeceh elie Pedi ninfo Guten ateemo ring susdoroteunteran) Tite ei sept wage Tecan typed doe serio hehe, sepep tn) ‘ida spelen saint ape avel exrai-cloth cng fe ca rain) Se leiathrapert ye sab thatenlaktomie iratatecseatowt own sig) Vieayecr kaysette setae iP iet “iho echt) \ipuninairbatceereare efit opon Frame Sete mith flee ebaret ‘iets apaionraneprene) “isbn ‘wien estoy igo) ‘itm tieayon eee sinc ‘tse ay emoi “ier tam poi) aero em terete Choose mess senblewone nde 2 Reniteah dine, inbeettthe Tet cold calls niece fo bing le, Teinwihtte ingen wl "nce yor poy doen echo aengemen “Taskdown(encethevhesienno) “ipa racked down bien aed hin, “Troutman "Le tnyentbe ne aking machine Turndown (jaan) “nai companyoffeedmejob tI ned tem doa, Tuo Gapencobentncad) ‘melon tea (ometos ming reformer) Trost offen terest cemeeear, Tunvp edo oye) ‘ort wor awh ming bok bond tump one (arvevofies ene Notun power theese. ete “cpetiy dns The panier of rsa bar ‘Woot (cue sho work autor meuns) Titel redone 38 Activities 2) Tonga scale spr 8 instal owro pent cscs oul 2 tect os twent chin 2 Teer had oop acme mart 9 Heeannerpedup cpr eee 1) Thedog did't tke ots : DieneaTepie ney king 5) Tulcea orev hele eck 9 Aleraweckonsbe the exein rani iil, i) They rely phil iin sera 4 TFS sentra vow The Foreign Seeretery he ben forced onep down. “ 1 They elise wel epee re ‘maclear ams 7 our 1) tebe enc wages sonny yaa 0 Bas dasvliyiiong wd ) bance ois sancdakiglnat specs UP p Widiinetmmeelclace aisle” "DOWN nn maperrilac say toe our » isa icant mades mile w » Taam pec dso,” TO 2 4) Teen leon te 0 Resmine Darcie nef gh forded Pose. 0) Don besepamnel oreo cetera 9 moat. TREES, S1enaijon torus ——epelen gen SOIR} Menteametiedieaten 7 Peeve pedi brebense owt won “ 2 hieeyeticdnc nan nocisnde store psn pn 3) Whneney dhe leer BBC fer? 1) Dawtrey abot ee isigdog i | Lp obese bane! 4 1) rane he Freche ely wl Ban een ged mato ote ech Rewracerch Tins draugh Pees pln atone - Ceponnges Tree — - Theale hespile west eter, Ralttettee peony ener 4) Merch akosons snag peo, ‘Seka «0 Huy enor weaned by ipromie ary arte wouldnt fy Thermo opemest ares on nce 5 Sdincpia, Indie mange Genes mc ood nes pa = 1 Teflon being sain Lsmenly tbe. 1) Sayrared down ap mais propo Ssay idee ™ 1) Secale ciao atng inp ‘Siepramdel 1) Top tendinfororatemeing Toaytok 1) Seperingevebody! Sspromingeenedy do! 1) Tryst inored bere our 0 iniienditwedicoverl th jocwaresice our imino aves our ie oar iad Baccara 1NTO. iit yooweten ovccged aan! on 1 iain weahodlinceacilepecwaeoehotaraign UP 1y Teoetaiow sang lnm casoon 1) Faecanpay astaaginapiyslgeolinaandl” OVER 1 Yorson naire om tele. wrt 1) Thegoveraeaths llores an 1 Reber wast bye med men nd eed 1) Why ds yous formed ying nig? {) Letran—thedeaivabenrsgement oc se 1 Mout wy inten wihaarerng he poe 1 Foeramsne ght anurans, 2 Taeulinwinsae ss onanenberaflow 1 Mendes’. others the pr, 3 Nooncespeted te orerntastand. =the 3 Onshcalrwing dort perl sc Peonesible covinech 2 Frronesinle Todincah a Rewriter emesna Unit 26 Progress Test (Units 21, 22, 23, 24, 25) ‘ate imam eso en gear hat Ipmaraiyme sf} gen rel Binh anit Famer) na wllimagstine Peo ighigs = ‘lpg cov hudtcn or cowatf) an emgeaton Ba hhc tgs mentor poles pone(0) sg Sfngsen ad Lock New monterey when) ines atone dish onary Somenewrpaper weer = none oucha hale Bon ol Exmor ranma sro) she Sots handed ep ove aye Barapa now come (1) an thro! ach oi weet cane arsenate (3)--—- alielbond Seal uoy ertecnsandone sasikeherig(e)- sacha Shesiy rewind (hen he Degros Wil Asim Ata 76 ‘Shear ofulcemedasnigh overt snccape 8} fara ‘neuton Bhs one oe spnhe wide enimcl ro Secand Atcrcrmining har sumpler pen ‘inde Bene ol Eamon nthe South Eng (2) beshoweh osbapanacrigme Suhel shihanonlarenomaly verte iia A io 1) My cntin earring i 1) Mloylonenlonteneiceor amine 1) Thea tierersnescepan ry le Shreve gent Sortiveusebexpon. 1 Brekingksige cd ine ps eersataece, 1} Dortweryshevicesenionit---—-conel 2) Tresumerlappemirupeine bow machyouhanepit 5) WanconpeSregrd——herow ae Aon pe wre i) Tsou sree apenionantyousret, 3) Tee steenepeople-rexhgot moved eer 1) Youth am omeoneee Yeosrecoeoing 1 Gayaprndol tc eer anype : co Suds page nap nb Phoebe - 4 Choorthemon seratlewordor ie 5 Paconessiate edinech nee 2) Mashed ©) Mist dilbert aon? How exactly doe uo vows 1) ecm ipon Onicha one 1 Theremlewarans joo id, 0 Anca fie rdabeecanah ete ‘Tetmd nen eet 2 Lay tetanus Thee ben ahs 29 Mhspn ef. promieyoeyou gm cri rit ee ig oe Bes Wythenshawe Seale eee snc nhs igi aC Da pe ge ee Peete yao Asad do Bi ale See Ieper gtr ei ee Sy 1 Neneyon abo ng ow on prop Paar vena oun * orton ti Mies inal ase |) Lean’ quite... out what the signsays, 7 See aad Ga ope 1 Hal it ten rein en Sp ge i) Wehe ap shagei i sere en Bae Gnd i 2) ok aileron door lcs een — 1) Tepeopemevepoeng. i ‘beara eel ri 6 Mayne beta camp ne Bean ety de etcierenn 9 Mehacimet aphex 9 einirica 8 Inercordecn Sica forte rm high pea ar ‘ Rewer Ferenesotit Serica Taioaaree eninge 7 Congcench ‘Meco or Pew 8 ares vonines 1) Cou you enn you nid? We ned o haw more dei } Talk joo weulleed--temafew dysaldy. 1) Whaccaly dtl AM and PM men? STAND i aang comes inecwitaarore anny” GAVE «4 Cacipiacnal eaibchniandenand mp reques. MADE iim ees saxen 9 inweiciieieakmycicaeprpzeayoi ‘DRAWN piionhedng ia cernvo acpi come sunk 1) Dost meine ing mony Gergen inn be me, 7 rn elm eer een. Sima Failte eaten he Sy Seo ior pmb aos delat yell wonepoe 2 ieee ae braver eae Bireeteet Ulin ilar od yon en. aon tan comctrdeewekbaenwe dtp for §) Whefar hehe —— iheonet ew epin 1) Werder ewes ge you 3 tyme frog heir chon Ost mlne Sang opps athe afice 1} Yortardy enh Shem you 1) Neh neste courb goto i} irnerting hw uy th on cope 1) Dowvwory son Rewrieen Sane shown ht seit 10 Comptech seme ale word or a Rew ech Ines 1) dost ely hit nihryse bos 1 'Done hats gone 1 Shecomeround weathers en 2 Wadyhpeay than sey Went pn by en ena enka i «0 Thowwe scons es ly ‘Abusand lor. — 1 Downe ka erp peepee = 1 Mann eeepc Manin roignds nnn = 1) Metin bpain a Tewternnetece tendon had irprnndernaonnya Sajna 1) Aeterna seme 3 wy a ard a The sienna Tete — 4) Joe pens ware ve seat. 1 Bosepedbndyandewa 9 Bemus Yenkcre 4 Thepmehsersceld hicks mer ©) Mosteltbementen ween vith betty prem abla actly Psion theme ors wk 1 Vmalnid tha bok not oer athemmmenbacceree deratoryos B Gre who nm opatou pry igh Youre: boyd Har 1 tans on.n nose ghing oben fund what evs aks 9 Danstpaseon Teralhereatiedeopsrumen i) Mesaned sing ike caer 1) Many esos esision witinthe Chae eae. AWAY ty Themnige premio ave polsdaircdwonce, DELAY Tiss atlnmyt BEYOND 9 Wise youinaing a hones mt we 1) Joegeson yer wl thie then, Tes 1 Thesainy oop mari mabemele ert” GE nein yout sibel aEHALE our : our 2) Gera anh shinny. Aissnyene’ WByighs aprcce s)Oudecnmary 1 Rhipetowd_—. nthe porno cher te predene Aameiost Whip Clawallo)doppedin 9 Tharschne wife been by theendofbedeade Dckendownayewoat C)pardoutS)madecttsih 4 Pomikeded atten eceaniaDecenber, Sukeen aiginlr Cgsrodio o)makefor 0 Wehaiet foray ealicand emer Seapeted bugil ceed D)uppeed 1) Whaterfean anton theft Deen ete e)sesout —ejoaktor 1p Tiscomevaonroctlocks poig bri Rintecwiyeope BinsiwnceChndernves a onighe wy Rartenpoeee bok yet Spotl syowceu—e)dewdaped ode up 1) Thame te kppr cooing ny et puma seaneupapis Ceol ovbeleup i) Deka noo mary teecon hes oud Saeed aed Cenacle Reece wont, Tox Orien Unit 27 Text features 1 Explanations | ‘There ae my fenefn which pheeade vdestndow he ifemuinintbtevpid Ascent higher 2h Ntehaheopninclnracacocogtehe pectin 1 Thiabac ‘Wiinhete wordemay ers le sendy meno or pin nwa oper tch kh wer conmoniete Iethend th goverment deed aeons ‘enby rad Tadeo bemorcdifinhaneareipced oases 8 2 Such ‘Thsbathe fc tbe Sachation tment tbe ere dif hn at epee however. Thistum cove wide rege nnd sada Aden gen re. 1 Adding pis There at abet wert besonired ‘Aust ovis dene the ab weather ecoidered ‘addon thesvios denen het wuchewener be ones [Nether obit Lengo btshreu secon beeen, 2 Cont ‘ly ficaadrstmn pte Henne ae a . ‘aie hanes hone anata seeped Perc scien th Fe bmp have lethal ner Tier cashes bys nenr hr releared. dele fe 2 Lage ! ‘Sede nnd ct nye prin Psa a fice tan ieee 2 ‘areas proup wor wich tog Sethe Words 20 The seein lr wok onthe Soe word which nd in-ear nade prestige sous resin “Ninccrmoal sen yor aiid Activities Prasecnshis iti wttens whichhnesing wad ining See lbveroe Lindale Neches arenes enn uy icing igalthiclyeattintenet TERN SSO itd Wenandtctocints venoms arene netonstemy on dae Senki ta ecards ere veces ily pa BO teers Sr arc tocnt rr eetbonge toned Sakray deena tytn TAS Thctsahiagagn riot be nerd calcd tniasen innate vo syithettacrwnen fics omens ocen aoe ecm ern wehnetaatt) en pete et cnatmoeeltne api Tie eked a= ly hy on tater any hed TEE Se sentir. nok setae ena aan oto Searing your) indoenence oc) ec here are ben door eaonngefhe Engh TMtaytenstr sve wel pice 0) poe ene (else toler bc) mong TRSSENePeacoed inseam senelerorimenhepace sce ()- comet premret dearer Aten remontic Along lisineatay ees Pn patecaen eheneernmay bead deseo chance speech edna 0) tend SOhoneshanpacty np ind enti err ‘ceremonies Spel prey fone edly ace Tere dsa Sitinoalene nen oui es ilonscacratenicsone hems clonat) aan Ohh ‘nyrcntma ashen hepa octet Fe edn celontan cate he potceigbe need ning esl eprby en Sait Proce Unonrnndhriea (on pen aracoooneoe Eimintcendenei on eddosiatcemeset ieee: nd srg amy om stom hig Seiolicemectiewtretonn tee When ete ‘renptn rs eereedle can he alec ie ‘Shiowe ant los heebingegay sesso) stem yest neha Sings endenobehciouciisainerpa eater nding nein cet ener aaa ‘reetmmeionidtotrovtang convo oes ee Frtshncipeteyemermarttdion rece ine ras stg toes) hermes anne Tk Tee mymensccwelr ne ape oaone ‘coon cag Mere) eae Sterne cera dei lbe see Gerace kha Coasonepe whee eadOhe lsh tlh inresasinbenineiont ie smergellpmeny ti) owioninteene med Selon al og ee emt) repent te eg chee a) jal) nae {oernan hac aw dey may rage ‘iri enelg pte hrs) eee Stony vetoing hop pen ee Siti toned) won tae felon angry ess a so mn Ere) ttmebowinb cle ie aes fo Fee me melmenshog ete (acca ten hinders ‘hsdnks dope ctr desert Yay ew poplarspcatr spn ema sein) thepanenincr) “Tenens orig eer envingtarai ear be Oo ia dtiiona saingcoarerno pends fhe reeset abjetseclgy al cology ond “acpi orn relied Nene Serene tieywllereriedby pacing “emeijapeidby econ ha no eae Tse anges toaswethe coma "owen Be ue pobre ei erporretanecbiut shapes beny den Sanaeing vee iinet al erings eed er tise erally del obo Beran (Shesnsiog®hone-—-ahewe Sesleri Sch tca ny oneness So 0) Cnn fe romone eee torneo (Oia py loupe doom brn ere ieee Taree 0] onnn OMEN ae vg clngs pier checie eters Saisie ence Ha enchant ee hbctimpnd om ore 1 tienen shane tae er mart ating leon get ce pest cco Bahay aed kerning shouldbe Gate shens some hae sade ts vata, acer Quctea chien lla Rome th sme ng SE pt erolet ania Gn torte com Smet ‘Shel atte vet clr) creer ramping) my a one Terres aTesi belong ge died oun hard) mon a wha acon (Yon —ctmleo bent FoeaeSherhcr stl Lc madesomeclle adored tomy ere ehicemeremdteet Debden reece tareebe ey elo dts 2) Tears nyne hn ate Teapots Ieee Benen th aa ce teed by hdres eros name. | “yale ery aking or 9) tea) Aabvanced Langage Practice 6 Pen workin Shee Iewahathad gone or wondered wher they wer lig nou bets hay reentThetwo ira suptanl erty ng inligle queso (06m frig age ater wh were?) can ‘uerons And thy hades dance ail ces waa by) surames receded by ho Mnatin Gout ar ‘State than rein ath renal he il Gand eae dy Alin). ey mea eight chops Tam iony ‘cpr thee ey ad abe) para e Engi ingagheratots saa ppd dona eligi Ob wel there you a por ‘Thee cca veg shin oid ome wz aconeinvloce int End by theNomine()-—- he Normnccngno, cain ‘heal Atplo-Sronknglom hdbeenG-n-—of erga ie ee) mann shnthe pe pono lees Receser Caen Renisagoodt) ofa Nomanoecon berg ‘ale avingbeen bul here sera 9) reenact Uheprciatealhsewiassirsnumediohaeaced en thetnee ‘end tty wal anda avecomis )=e—atvedot th ‘around by ald area Thstypeleaelaricame@)nnn athe ‘naceand ay cae The mouctonne wale we deed ices ‘Sols andtoers Thiam probaly th O)ee bagel ‘Willan he Congeraen Royse hiateson oto Atos) no Rar oid ose spon fh er ‘eater Raber he Dakec! Normandy whammany ihe be elered (2) ne egelssil oiid ogo of Nol Enfand Roch Case bene sforrlr te revolnd een by Bah Odo. Evenly thedeenerwere(3} toate od. ‘ere oma Egihpsreions Tha poaasaet) ‘houptodie on ser thesiege anda buy Gl Ssnp of Roche (1) ast witha hecy ale Head bathe ‘disthsowai)onn ara wayolpayngollsdatel 0 bei ‘Trek? ona Berl mony a payor cater Rach is poco land cr Boca Theses CGelewasbit on abd 0) —-nteseath menor of eed Roman cy ofRochestand(19).——-heremi of oe aman aioe iseondatinson henge Teas nf) ‘ean stan outer dle sthoughs a a erly pc nmi: Masiyng wont tape Unit 28 Text features 2 Explanations Sonetees il forsee pie wich wil: Tho eis SEntohedy seis ™ Fee nicki te geared eof ef Tflepains inion Sone ced prc eg 297 setae kona ‘ee Suurinpoe cary bipliy Force infront seize 1 rani th hen lf ‘Adore is mere and mare cit {hur bsbennad er and reset 2 en onde ofactonivenduledy prea » Merl paloalny mph “her ey yon a [Slevin acs of tid Innanfonenophepecstsvageedle Trev ten orate 4 Mokinganeions bsp et ‘Thiel acing onthe perf heme Thamoehbelngincsnerf gave bo. Tether ofthe panama gg ie Treen plangd nate i Tiewbelyonantey wrong Thenter at eral pec seaman til te cop tewrdilowing hdc ean reraienunpe thems ad ey thio her vos hs 1 Chooreehement swrblewecdor rae oreach hinges Geof heme ches PfesrBenn. Thistsncumplelgeoermen efor Foreumplasegenchebeo hee ge. ‘bec efi Coding tonne ch pete Linking esd “These worden perfor olan “Tern spp myn tay beds ae Acbérerra beetle uagedacterceech 7 semmacng “Alina ice Fold hooey ommend 1 Tar msring he ‘Tissot by phe bch acompa Thevorseonlqatemtbesee va tae 36 Activities Prien hic ite Pr which bie single words oe phe hear gie Sein and 8 fone kanes " “Whatcan henge Bon dtacrenahomeenonmer wich andiendy} Wa (0) wan baring ara) roe hlne ee fone bli onbeingeons brO).-- pedo lve hiss treoghehe rand ol Sol) aa sean _doable glazing and loft insulation, The next most oom sone heengmteapetree na wy ne ee plastic cartons instead of wrap ni nd Sols nda hp stab chu eon ee eli 0) enews eagoey geplein ‘ancl The pentcoisanir chee inecrcnese Se ‘erent ing dod epee se) pn theminte doin Andina em ther sigs ee a relied Sipmwrefommyon Mehcipeseaes ene Thsebconingsmereandmen res commadin (9) tees seen Pah hin oa anal ne Thesstonrinneal olan dons neroneng wl ahr clan orth And done shonppes wah your carer eae epee) onncbumedsnsonsayn (a) enters serous Ty aig omen shake ned = 2 Chooeibemce Sableweeor sieetoreh 1 ifn peion sJonecoudbudly cfiteal obyhacine 2 Abe Bow Sones Ol 5 MeSiady — Matesmesine Qseertas busier i nee satel Quukn poi 5 fom Mie Souk Bite rani Dimed namie ha 7 sone Dune ah hadanage tieh te Gauche Bhoe > WMeresnd more 3A Sincresng 0)THe 1 Mier dope a Dhntead i seb Seslowing Sit Spain 1 she re Guest Ohapie 1 ae Dee ety Slatin 1 ite te These olsen 1 Sinsyewe Deere Shen mely “Terni bwen th Bah royal fay andthe papel pes Tinos eee) es tbepes ha yeroreaeta ero SESE AZgoee ttle glen ey Roy enc andropal ders ernst pbsopnnkesndrpponedty hws kind of Qiiciticmeanbre proven be) te tingor ing ret cans Thea pope oozed eine eo SESE snd dente ove sted pone ewe oa ew 0 send Etcosryainosepsatienerdvoree Every phoopraphtecnes ‘ithe eeee nervous) -——- pra eons ‘Sees mer pnd eh ar oe (nnn theres ere eee Simruto she prey fmt fh ye REE cose rnnmonpere (sonny ue EE cease edi gun The presi eftheraaley He need hndhow ei ote [)mmmrn--mbeer [Rettcbees red imsone bdo operant pe {Ceritoson theca ocr taseasflrepi a TLS Ae Meglio avsansiow na proplecon usreoueeshe crs caytotemrar ols eroafcrdeurd creer. Andiyo0 erychig has hah (1) cnn Frappe eterna beacon (9) ted ues lee bued ee areu ded re of ears he etch) ene conted Ie manhole Perc lt call Blane And (8) onal See eoatflmancacansonbuoner, oni haved os folie geo pod TabBntefa )fameny pec ewes s)A render 1 Uetvik Stow Dbwingub o}proie 3 amide Rely), movetan | Ds Advanced Language Practice 3 Choose mon ‘tle wowdor Phrseoraeh 4 nie None ene opt Sheen Die Chiee ——Opdapteteag 6 as Dini Whe hee T hehe an Gach al B Aundio | ainwhich —Shubeorer—Shiaey 9 Dundee ben Sacely hoot 10 Aibepinn” sibeone Jeli ieee 1 Aforeumle mjons Qe hha 12 Alina” Nateend — Qrereorer Bangs 1 ihe ae VThrewe yey eres 16 smery Surety enemy 15 aiden! atealy——Qimly Bh youl vomehing iti dient way fa shiagholitn ey yesh in Gam’ Teanga gene nee ‘ry, What ce blithe utes) one Neveds Youbweteuneltyhleeperehe leg heh Gh eet ied an bre inte Rocky Moin tad ince ‘oud during wine month(9)-—~ fig ca eny arse! tinge elope 50). shen gueve tte ie ou aio forabeicaper Asians downto pickyouyp tne seth oi Lromshrotn den Sow way yourhaacdeote and enol). Somewhere inthe snowy was the bloperl deort yun dases (onto opel ga snow Tesppedisen cea yo the buys of arpe and) Amara eos ou {eli mies romtheneuettonm andthe conn renblag ask or ‘blero yookaeto( i). onl cian ihe Youpe ‘sectoral moanuin-gontorpte tog but ore wenechosloet Prplsided (i). Thaeaeonertwo(ld) ns hove ‘ar romth conc yin ale ay Caad Youbet ‘ight tpt youdowninuiteen‘asanw del Your ge igo ‘berethetnow neal users bonded oo deeper mgt yon eo ‘ne (13) ing weber hich mai ped your epee sole yoonrandenthewderne [ovens tugh the wep istheadvensreandheailsaton of sings opncomnyon oh powdey oo: Softee ara you ad yeubine sour falbeeendensoca Sali andthe shingaiiyI3) 0 with coienesemghe at hetingfor you 1 Ming ico ihe chy we 2 Nally sking ——Gasey pce 3 Nile | Mautner intense openite { Nundosbedly —Nnzaly— Chbrouhyo}anely S micoper” —Nandafoune Chdapictaeo}bur ‘eta rove —-lnewpin—inwinak final eis yertathe Qian hamewin lowe acer Ghat Slee Rewtebndyfor Die Si Se aie Dey Sai Dieters Ber Rie Sater ates ‘iene Dascomnes Saenger Asaerrblen Wesremics CJOwample Sad at Slietst SAkbough | OF ylateend Srecre dyoustee Chrpropine. Dane ‘Wert commeny siswple Unit 29 Text features 3 Explanations “oss mayne pa veaing vie feed on ping punuaon sn checking whch wor ve eee or nwo aed "oom ‘Rosie tt Tecra stant epee ei Sopieectgiremmenmpanecet Spel lc Efe eg lie herent Feenge cnet tarr Thc ce th Tern betta oon aes ey oes Se ge ioe ioe | Paw pit Sin] le | Pe tee ee eee tet |, sn si ky [sou soo | ot ; ete Se ea Rip Reem ar terres & mas tay, Eigen rs Sine FEE Feature Say Sormennana, Fae emt Feo Salah ‘ord wth heanepromarionbu dieeespligand mesng ‘Thsisveason thee sremoy eh owed aeed hacer peau patie) thts Seach pepe re ‘eee Die hope a Taman his eerie ‘pig npunes Ditefeod line wrethe nec pled Serostowthe See nde ‘veainerehe See Tecctmplee een 1 Ags : ‘Apewpha dail (Zovecenes Ceramic inert oes Jacky hp nan the pepe decion Pamesiei dee acne nsporope. Plane Thowaretoots ipa’ Aree Te. 2 Calosandsenlos ‘Cele inroaceenamey and eet which eine wha bs erated ips ieee os ob cure of actin hers he bash inform inode monn rahe Seniclomdricepre slong ven ot og paeinaiieraly Fotodidecne sete oberon tae clone Activities Praized pro reading Se Ui 2nd 24 fr cther Wsenaeped gar of eed aomlgatosnime ov Enisdepulicdemiomdowterertisetiy Opa ‘Retrtandveyntierwec eeu grownandthe Ona Murcunssinennbonsebihsdéeteperseocts 1 Tepes Mfocdwattesnnottotnsedyouhadthe 2 ChtetomumieioseeseteryoumanedieWhenyon 3 Sauoppngyencadorcuctwhsrpeseaf mentee « Mncesdurdebuchercuingkimedefindngt 5 Taljwraped np Andyourloe adem ron goto (Roe ciaouwaneyandproteloryu shew they lhe fonctions, Ofeure gles weir Unewmeesnllecrknow ohebertiesaliwe Scene dniecsn dayeraaiedto dake 10 dijeonvenetfendgaso pri Good OMDiys It ‘Sherismlesildsheoven proud hckredne 12 Ipnedolwaerchencookehsndcontherimessscencl 1 Cake wharaytorgsenbrthenssnow heey 1 Clyourondepecemven machaponwoyouwery 18 Rowadhalycatependiobsandwheeyentives, 1b ‘Sop ben demanedsoieblestsndshoppes had 17 febeieieeliieteetremibenowoteck Therear 18 soncty dmctortaragede Hyovwerebdepies 17 Froummenundconcdtiod? secdhavebenontbemenn, 2 iene seedy 2 Theciemon clastic heown illite Inmontineoshis fra ofnienr toon andearetreet eae tetheinetera ih popular myilgy Arie mame ope oegn ‘ptigorpuncn- tha youcathscal mean yooteene oe ee UhoctrForeuh Aswenow batscellgrveus nda lnewrtehe "from bog imecesct iene ‘orn iplled Shing unde hec weiterilowibe saneroom can ur ontesan Gerpocustan, thei vacsand iach oe weaealncki| *hiseno sy e, them out been Isaow peel eed thanonetypeatelnsye inthespeebene penn the roses cnly tome sae eae hc ‘het adcne Feneneoilecdonslaveed Teseiechelinien fen ‘ouccioe witha acksim merinin nthercanitaereniee teas ‘th Taeeeampe become tied nl epee ‘ets chore geal, Sdn clay, edycondeadn wat feand ht be nie Svnfrouiereedy Das spo alcio by peo hope inched sheetbeskin rome ndint ino tet massa perked ‘anole the bch albophyanendaccnsehe ‘alantotha Jur bebgostinthe tll sotenogiroad fe eg cops sane cole wasnogreer Aan raed el erga ie shave bet ale pede an eve vce isco soup tongs aca tmae foramina indsaidterecove, 3 both prerenaive ree ‘Avera ibe wef Egan made cat bythe beseaer Inmontin fhe the One ontenpinbocomradeteeete ut slocing bul polion sping piet from hee Theives ridge a Noreen he Senex Focexch_ sting or Henry Wilanions back tesccanafwheh os ‘exile cibera.yesl what ad bees lng wiethe ledtthews cig Cosme sonrciy piled populares Saris? shear wetkersdow he howe thehunan opus cen oxretpncation, Shee fll and eel west pe sndbeomings took wa write, shined odie, inthepcbeite” hdl thesis beng dale chech cece thee nde eghys Ones thyceuresensticnerete tere eastiesvithe _yhnumere ple ohdesong rion olen en ‘st Thee eample fear waa be epee, sey alundereband ‘herent es Sisheom eur Hover ‘lease ieee minted neo cng handiheatecel chem "Smenionotehening heh unter of proj desnelio shanti dapes snc snouaenen eter the yor The ot Proje, oxy ogre: 2 Seer lng ‘4 Inmontneet Seabees Sood fentalhor Feet lend hese Tevet wie ‘rd ace Bridie Tokeaheoet ich lcnnt and nivel on Snbtenerpconyenoe Senet Sehticcehecntantenmnaafetsandmre 1 SiatSingelonineeescode We * Wonca pe hone weed ‘ees lie sae uebarone remy sinnite 01 Liter Cada tomecommenso yout eb: ae ‘ihc oredesmaytnuinectny 80 eevee ftir enone ae Fla iy ageessbyournceMerGatoend ho 1 ‘oronduhetateltanminlercraigtie # ranundoctandcarfadegietetnmordiieek 3 Spuchdeitoccgmdertimonkenolicdedin + ssiphenceninen neti eseslcopy 3 ntelinGaveaietnwtnaratine & Assuming docu osop open et ero elem resce & {long hetenineinsome pdt em : Sacre riven singin nn tekatewanindbneretegrngetat 1 legwchbtyegcnhneotnsktooneomie Sioninetaleegatieneryatbepeganmetey 2 one am eh eee cel we ati ber accede roarng oe ching. Asforthe cence 19° cieaigraiteaanmages” souyer 5 - emote ot Sever pomaiclor Fevechlin er tecuatry odin Tirieen, 6 Froeiatlor Store seneol deere vod pae Tetkeeee ‘Tetem’drap cover may finds of cei abe TEE setuid hoch soy og IPedines esped ocr lens Toe semana Fromawsrety sour ih ade tala peda, ‘enand mie nthe ees yh come pole {oeymesieinthelausny many ds which revel hind fom pi and ema roses Aamalramberel “ropenberome denen eerie toolreqeiorin dere hgertun sey commended gprs reed cpg pil nth oe ine bu kinprtntc reap ct ‘Sutuirchesbneaf rp as occa pend ‘ocilpeeminmy tie, nbn hedge ‘eybie many enc tee whence medy Thies ‘hy mend reconlesly ough rein an ‘Tour Some pope wold aurta fasion drege Invlvesbohpielogand sel ictorsince oer pProplentobecomesdectemaySovosiordertofadsone ‘it lnm personal orci ogucn Tet argumen Ingest romeo hdr arse ‘eomeraddted on ioe power pysil espe mny do Alors temprsy tele ‘ne bong may techie heretec oon wear ffaread Serer pina deamon hichsrnoly entered ptf crecibe dnp. Araya ay of eth conden Calfrsia come, ‘peta nreningenlosonstheophre rig eee cpabletoeverbndh The rsiconlnon ia at ors Fama remin hth ee reopen Ande pays Theta pops epiiog ‘spelt seach Ronee atic te Inti iaropine. church gig anda {tonal Aad php ees ach psig oa promo the keh hsb der ee [rome the lho he iene ieee For rsple shenitcomecerprenigeneons sit {owl sreth ring an ue cig bay. Butecntingto theyre may bebens fore ay bacot forthe come tan end Snesihere sons snr cing of pul her he [sel i bcomes dense wheres fhe welt send demineonteargumen hen shin bch they nec whoyeme stewie They abofoondsht 15 ‘Reine dpuna int domes oten ep 6 Whyrdiomierlinucetecoesiemind Le decetcackoptewictc ances 1t TET iceemlanttericrtyiaed 1 EoiRyrcae welbig care eda Tanai heptane eager atone asiaie sendin Conpeeach sere th ble wond or Ps. Unit 30 Progress Test (Units 1 to 29) ‘The port Dovera Sth Een Engine) onsite ‘nay vers from Baropes te appro Ben om conn a Enrpe The famous Whe loge teghhe mieten eee ‘ichrbe andthe paseges choy ty eds le tcugh Gon Or atest ay eal) tbe Troan’ shang) andes ea ow otc oom caring adr fre abe denon vi onmpleymen eve Eachene ge h(n tn sand an Ws Totten fcange ‘0 <——cintheiping at er forse) nthe ‘Chorio which dveestanorm eve ame or adage Fite Bia frp iadewithov beeen tery pangs sallontalove (ann theblel ce crom Cho ll so “xem the neem Dover) hen ee ne overte etdeie 9) ~theaalpovie 0 (09) tng comet hss ony seporay adverb ye (0) abetamel je bn ey compra edo Indusishavebemabdaing ne ntalon emer) npn poublefr the oeernrhe whch wstocons The(3) ot ow vaste peingal Ep inal athe begining 17.Dove Catone 4)--e-weh or Seonne ihe) an tomenon sh holt as nelincooeme ‘woking trgctndirsprenaenendety await) nove, schchingesheeipeldeconome ano are afomaleonjanse tay of (7) empayersrevdersedheensafrrcers ale wtan pak oneor mor orgntrguge Hope Dover ilove (9) mtr che Bane 29) hectic of rcinalnr inet es Jno ‘som thogh lal ueenployed ces omy frend rund ee oF helghctheend lhetune a desdaty every pope 2) Bhy00 enna wingmy cleo etch 1) Senge teeth rinse der han einer 9) Theghing wera omy Wen enon, 4) Yovaeaetl Yorum elanyoucwe big pt ) Thre nbd fr lied maerepectunecie, 2 Bctoryourhel uae eich wero ine Sa oncakingacipoltaeventhough chad ler Eee ne Onda ee Neer ng paudog ink you doting 5) urea dd aie uth nto con 2) Whoomas biomes? a ch “Who dost. = — — anil 1) Thadonlyjosarivedbarie when the phone rang, Sonos Hardly. a cien Sane g Dotuolcruayocancepeniedbaton emenet Oy Someone bau Jobe opacities (eh ee 6) Yona rset = Mpa tandoori Cece wy Heeler oa ~ Teepe erwin ihe Book 3 ei creeinbccnvarcierveogicbah Sar aaltyoo wont oda pool? i) Shel aoaslynepae Srv — 4 9 owning Revie. witiaidagwnildoyeuek «FRO Soliman, Hyped ston, = dso gy Ncbly chaebol Mi eb wHo atone Reba cee ane -«) Toboulda’ think Carol will wart to comme. a 0 Taacisowniogcayournind ae snout yiiclinccatigaduweapeacd "co ‘hy Fs aia rj inn’ possible for you tose her. Qi ny ante savour 1 ey kenge i Tiopaneyouare Perrier

You might also like